Details for Lyrate rockcress Locus 16052897

Position : sca3 ( 5`- 2341353 .. 2342099 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052897

Protein [Map View]
MVSETVSNTESPPLLGPRISFSADLSDGGDFICITPVMCKELEKDVVKGSVKVSDFEFLSSENVSPQRMLTADELFSEGK
LLPFWQAKHSEKLKNITLKTNEEEEGEKRKVEVMKKDQEINNRDNRVSWFIDEDPSPRPPKCTVLWKELLRLKKQRNPSS
SSVAVRTVSSLSPSSSTSSSSSLEDAAKREEKEKEGKRGKKGLERTRSASMRIRPMIHVPICTPSKSSLPLPPLFPLALK
KNRVERRT*

DNA
ATGGTTTCAGAGACGGTTTCAAACACGGAATCACCACCGTTGCTTGGACCTCGTATTTCCTTCTCAGCTGATTTATCCGA
CGGTGGAGATTTCATCTGCATCACCCCCGTAATGTGTAAGGAGTTAGAGAAAGATGTCGTCAAAGGGTCAGTGAAAGTCT
CCGACTTTGAGTTCTTGTCGTCTGAAAATGTGAGTCCCCAGAGAATGCTTACCGCTGATGAACTCTTCTCCGAAGGTAAG
TTGCTTCCTTTTTGGCAAGCAAAGCACTCAGAGAAGCTTAAAAACATTACTTTGAAGACGAACGAAGAAGAAGAAGGAGA
GAAACGTAAAGTGGAAGTGATGAAGAAAGATCAGGAGATTAATAATAGAGACAACAGAGTGAGTTGGTTTATAGACGAAG
ATCCATCTCCTCGTCCTCCTAAATGTACGGTTCTTTGGAAAGAGCTTTTGAGATTGAAGAAACAGAGGAATCCGTCTTCG
TCGTCGGTGGCAGTGAGGACGGTGTCTTCTCTGTCTCCGTCGTCGTCCACGTCATCATCGAGCTCGCTTGAGGATGCAGC
GAAGAGAGAGGAGAAAGAGAAAGAAGGGAAGAGAGGTAAGAAAGGATTAGAGAGAACGAGATCGGCGAGTATGAGGATAA
GGCCGATGATTCATGTTCCTATTTGCACTCCTTCTAAATCCTCTCTTCCTTTGCCTCCTCTGTTTCCTCTTGCGCTTAAG
AAAAACAGAGTAGAGCGACGCACTTAG