Details for Lyrate rockcress Locus 16052884

Position : sca3 ( 5`- 4191968 .. 4194309 -3` )
Annotation : [B2G] ANAC050 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052884

Protein [Map View]
MGRESLAVVSSPPSATAPSTAVSATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGEVDIYKHEPWDLAVFSKLKT
RDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREIRRDIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRLVEYETE
TNGSLLQDAYVLCRVFHKNNIGPPSGNRYAPFMEEEWADGGGALIPGIDVRVRVEALPQANGNNQMDQEIHSTSKDLINI
NELPRDATPMDIEPNQQNHHESAFKPQENNNHSGYEEDEETLKREHAEEDERPPPLSILNKEAPLPLLQYKRRRQNESNN
NSSRSTQDHCSSSTITTVDNTTTLISSSSAAAATNTAISALLEFSLMGISEKKENQQQPLSPHKEASPPSPIASPEEKVD
DLQKEIHQMSVERETFKLEMMSAEAMISILQSRIDALRQENEELKKKNASGQAS*

DNA
ATGGGTCGCGAATCTCTGGCTGTTGTGTCCTCGCCGCCATCGGCAACTGCGCCGAGTACTGCTGTGTCGGCGACCTCGCT
TGCTCCTGGCTTTCGATTTCATCCGACTGATGAGGAACTCGTGAGCTATTACTTGAAGAGGAAGGTTCTGGGCAAACCTG
TACGCTTCGATGCGATTGGAGAGGTCGATATCTACAAGCATGAGCCCTGGGATTTAGCAGTGTTTTCCAAGTTGAAAACT
CGGGACCAAGAATGGTACTTCTTTAGCGCGTTAGATAAGAAGTACGGTAATGGTGCTAGGATGAATCGAGCAACTAACAA
AGGGTACTGGAAAGCAACTGGAAAAGACAGAGAAATCCGCCGGGATATTCAGTTGCTCGGTATGAAAAAGACGCTTGTTT
TCCACAGCGGGCGTGCTCCAGACGGGCTTCGGACTAATTGGGTGATGCACGAGTATCGACTTGTGGAATATGAAACTGAA
ACTAACGGAAGCCTGCTGCAGGATGCATATGTGTTGTGCAGAGTGTTTCACAAGAATAACATTGGGCCACCGAGTGGGAA
CAGATATGCGCCATTCATGGAAGAAGAATGGGCTGATGGTGGAGGAGCTCTGATTCCAGGAATAGACGTTAGGGTCAGGG
TAGAGGCTCTACCACAAGCCAATGGAAACAACCAGATGGACCAGGAAATCCATTCAACAAGCAAGGATCTCATTAACATC
AACGAGCTACCGAGAGATGCTACTCCAATGGACATCGAACCTAACCAACAGAATCATCATGAGAGCGCCTTCAAGCCACA
GGAGAATAACAACCATAGCGGTTATGAAGAAGATGAGGAAACACTCAAACGCGAGCACGCAGAAGAAGATGAGCGTCCTC
CTCCACTCTCCATTCTCAACAAAGAAGCTCCACTACCTCTCCTCCAATACAAACGTAGACGCCAAAACGAATCCAACAAC
AACTCAAGCAGGAGCACACAGGACCATTGTTCGTCGTCCACAATAACAACCGTCGACAATACAACCACCTTAATCTCATC
ATCATCTGCTGCTGCTGCCACCAACACTGCCATCTCTGCATTGCTTGAGTTCTCACTTATGGGCATCTCCGAAAAGAAAG
AAAACCAGCAGCAACCGCTTAGTCCTCACAAGGAAGCTTCTCCTCCTAGTCCAATTGCATCTCCTGAAGAGAAGGTTGAT
GATCTCCAGAAAGAGATTCACCAGATGTCTGTTGAAAGAGAAACTTTCAAGCTTGAGATGATGAGTGCAGAGGCTATGAT
CAGCATTCTCCAGTCAAGGATCGATGCACTGCGTCAGGAGAACGAGGAACTTAAGAAGAAGAACGCCAGTGGACAAGCTA
GTTAA