Details for Lyrate rockcress Locus 16052869

Position : sca3 ( 5`- 9043322 .. 9043975 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052869

Protein [Map View]
MEKSALSNCVRRTIFSNQQRTIQEGLEESSWTMYFETEDGLGHYDDSSMMSDAASPMGSVEEDTASSPSNRTKGHSEMED
NTIEEKTMNDTKIEEKRLNKNGIMIEEYCAELKKRGLCLVPLSMLSNYIG*

DNA
ATGGAAAAATCAGCACTAAGCAACTGTGTGAGGCGAACAATATTCTCTAATCAACAGAGAACAATACAAGAGGGTCTAGA
AGAGAGTAGTTGGACAATGTACTTTGAAACCGAAGATGGATTAGGCCATTACGATGATTCTTCGATGATGTCAGACGCTG
CTTCTCCTATGGGTTCTGTCGAAGAAGACACAGCTTCATCTCCTTCTAATAGAACCAAGGGTCACAGTGAAATGGAAGAC
AATACGATAGAAGAAAAAACGATGAACGATACTAAAATTGAGGAGAAAAGATTGAATAAAAACGGGATAATGATTGAAGA
ATACTGCGCAGAATTGAAGAAGAGAGGACTTTGCTTAGTCCCTTTGTCGATGTTGTCTAACTATATTGGTTGA