Details for Lyrate rockcress Locus 16052867

Position : sca3 ( 5`- 796198 .. 797691 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052867

Protein [Map View]
MASLVAAPISFSGDSHVKEHRNFNAIRKSSTLTLKTKSNRSHKLSVSAGYRAGSKGGGSSDFVTGFLLGSAVFGTLAYIF
APQIRRSVLNENEYGFKKPEQPMYYDEGLEERREILNEKIGQLNSAIDNVSSRLKGGRSGSSKNSSSPSVPVETDAEAEA

DNA
ATGGCGTCCTTGGTAGCAGCTCCTATCTCTTTCTCAGGTGACTCTCATGTCAAAGAACACCGAAACTTCAATGCCATTCG
CAAGAGCTCTACATTGACTCTTAAAACAAAATCAAATCGCAGTCACAAACTCTCGGTCTCTGCAGGTTACCGAGCGGGAA
GTAAGGGTGGTGGAAGTAGTGATTTTGTTACCGGTTTTCTTCTAGGAAGTGCTGTGTTTGGAACTCTCGCTTATATCTTT
GCTCCACAGATCCGAAGATCAGTGCTGAACGAAAATGAATATGGTTTCAAGAAACCAGAGCAGCCGATGTACTATGATGA
AGGCCTAGAGGAGAGAAGAGAGATATTGAATGAGAAAATCGGCCAACTCAATTCAGCCATTGACAACGTGTCGTCGCGTC
TGAAAGGCGGTAGAAGCGGTAGCAGCAAGAACAGTTCTTCGCCGTCTGTCCCCGTTGAAACTGACGCAGAAGCAGAAGCT
AC