Details for Lyrate rockcress Locus 16052832

Position : sca3 ( 5`- 9382850 .. 9383899 -3` )
Annotation : [B2G] ATMKK5 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052832

Protein [Map View]
MKPIQSPPGGVASPTKNRSRKRPDLSLPLPHRDVALAVPLPLPPPSSSSSAPASSSAISTNISAAKSLSELERVNRIGSG
AGGTVYKVIHTPTSRPFALKVIYGNHEDTVRRQICREIEILRSVDHPNVVKCHEMFDHNGEIQVLLEFMDQGSLEGAHVW
QEQELADLSRQILSGLAYLHRRHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLN
HGRYDGYAGDVWSLGVSILEFYLGRFPFNVSRQGDWASLMCAICMSQPPEAPVTASQEFRHFVSCCLQSDPPKRWSAQQL
LQHPFILKASGGPNLRQMLPPPRPLPSAS*

DNA
ATGAAACCGATTCAATCTCCTCCTGGAGGAGTAGCTTCACCTACCAAGAACCGTTCACGCAAACGTCCTGACCTAAGCTT
ACCACTCCCACACCGCGACGTCGCTCTCGCCGTACCTCTCCCTCTCCCACCACCCTCCTCCTCTTCTTCCGCTCCGGCGT
CGTCATCTGCGATCTCAACCAACATCTCCGCCGCGAAAAGCTTATCGGAGCTAGAACGAGTGAACCGAATCGGAAGCGGA
GCCGGAGGAACGGTTTACAAAGTAATCCACACTCCGACGTCACGTCCTTTCGCTCTCAAAGTGATTTACGGAAACCACGA
AGATACCGTGAGACGTCAGATCTGTAGAGAGATCGAGATCTTACGAAGTGTTGATCATCCAAACGTTGTGAAATGTCACG
AAATGTTTGATCATAACGGTGAGATCCAGGTTTTGCTTGAGTTTATGGATCAAGGTTCTCTTGAAGGAGCTCATGTATGG
CAAGAACAGGAATTAGCTGATCTCTCTCGTCAGATTCTTAGTGGTTTAGCTTATCTTCATCGCCGTCACATCGTTCACCG
TGATATCAAACCTTCGAATCTACTTATTAACTCAGCTAAGAATGTGAAAATTGCTGATTTTGGAGTGAGTCGGATCTTGG
CTCAAACCATGGATCCTTGTAATTCATCTGTTGGAACTATTGCCTATATGAGTCCTGAGAGGATTAACACTGATTTGAAT
CATGGTCGCTACGATGGTTACGCTGGAGATGTTTGGAGCTTAGGTGTTAGTATCTTGGAGTTTTACTTGGGGAGGTTTCC
TTTTAATGTGAGTAGACAAGGTGATTGGGCTAGTCTAATGTGTGCCATTTGTATGTCTCAGCCACCGGAAGCTCCGGTGA
CGGCGTCTCAGGAGTTTCGTCACTTTGTTTCTTGTTGCTTACAGAGTGATCCTCCTAAGAGATGGTCAGCTCAACAGCTT
TTGCAGCATCCTTTCATACTTAAAGCTTCCGGAGGTCCTAATCTCCGTCAAATGTTGCCGCCGCCTCGTCCTCTTCCTTC
GGCTTCCTAG