Details for Lyrate rockcress Locus 16052829

Position : sca3 ( 5`- 2116909 .. 2115679 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052829

Protein [Map View]
MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQICGLSSLGYRAVAPDLRGYGDSDSPESFSEYTCLN
VVGDLVALLDSVAGDQEKVFLVGHDWGAIIGWFLCLFRPEKIKGFVCLSVPYRSRNPLVKPVQGFKAVFGDDYYICRFQE
PGKTEAEIASADPRIFLRNLFTGRSLGPPILPKDNPFGENPNPNSENIELPEWFSKKDLDFYVSKFEKTGFTGGLNYYRA
MDLNWELTTPWTGAKVQVPVKFMTGDFDMVYTTPGMKEYIHGGGFSADVPTLQEIVVIEDAGHFVNQEKPQEVTAHINDF
FTKLQDNNKSF*

DNA
ATGGAAGGAATTGATCATAGAATGGTGAGTGTCAATGGCATAACAATGCACATTGCCGAGAAAGGTCCCAAAGAAGGACC
TGTGGTGCTTCTCCTCCATGGATTCCCAGATCTCTGGTACACGTGGCGTCACCAGATTTGTGGGTTATCATCTCTAGGTT
ACCGCGCTGTAGCTCCAGACCTCCGAGGTTACGGAGACTCTGATTCACCGGAGTCTTTCTCCGAGTACACGTGTCTTAAC
GTCGTTGGGGACCTCGTAGCTCTTCTGGACAGTGTTGCTGGAGATCAAGAGAAGGTGTTTCTGGTCGGTCATGATTGGGG
AGCCATTATTGGATGGTTCCTCTGTTTGTTTCGACCTGAGAAGATTAAGGGCTTTGTGTGTTTGAGTGTGCCGTATAGAT
CAAGAAACCCTTTAGTCAAGCCAGTTCAAGGGTTTAAGGCTGTGTTTGGAGATGATTACTACATTTGTAGATTTCAGGAA
CCGGGGAAGACTGAAGCAGAGATTGCGAGTGCAGATCCAAGAATATTTCTGAGGAACCTCTTCACAGGGAGGTCACTCGG
TCCGCCGATTTTACCTAAGGATAATCCCTTTGGAGAAAACCCTAACCCTAATAGCGAAAACATTGAATTGCCTGAATGGT
TTTCTAAGAAAGATCTTGATTTCTACGTCTCCAAATTCGAGAAGACAGGATTTACCGGTGGATTGAACTACTACAGAGCC
ATGGATCTAAATTGGGAGCTCACTACACCATGGACCGGAGCTAAGGTTCAAGTTCCAGTGAAGTTCATGACCGGTGACTT
CGACATGGTTTACACCACACCAGGGATGAAAGAGTATATTCACGGTGGTGGGTTTTCAGCAGATGTTCCAACTCTTCAAG
AGATAGTGGTGATTGAAGATGCTGGTCACTTCGTTAACCAAGAGAAACCTCAAGAGGTCACTGCTCACATCAATGACTTC
TTCACCAAGCTTCAGGACAACAACAAAAGCTTTTAG