Details for Lyrate rockcress Locus 16052754

Position : sca3 ( 5`- 8395921 .. 8398317 -3` )
Annotation : [B2G] pseudouridine synthase family protein
External links : CoGe
PGDD synteny : 16052754

Protein [Map View]
MAKWRLATATLRRHLQSPSPTISAFKDPTKSLSAAAHHCSRSYSTAQTDDSRGNWLTLPPFSPTIDGTAVGKDLLSDGDS
VKASTDNSKTTALRWILRCRPDLPRTLVQKLFRLRQVRRQMSLSVDGHELQRSQLKRVAAKESLNVGDRIYLPLSVDNDT
PPTPPAKKESFQCSEEERKFVCSLVLYKDPAIIVLNKPHGLAVQGGSGIKTSIDELAATCLTFDKSESPRLVHRLDRDCS
GLLVLARTQTAATVLHSIFREKTCGASAYGVKKNIKSLKRKYMALVIGCPRRQKGQISAPLRKVVVDDGKSDRITVNDNG
ELVSTQHAITEYKVIESSPHGYTWLELRPLTGRKHQLRVHCAEVLGTPILGDYKYGWQAHKAREPFVSSETTPTKPSSSP
FGLDLDGGDVSSKQPHLHLHSKQIDLPNISQLLEKMQVSSDSDISDLDSLKFDAPLPSHMQLSFNLLKSRVETCDKN*

DNA
ATGGCCAAATGGAGACTTGCGACTGCGACGCTCCGTCGACATCTCCAATCTCCATCGCCTACTATCTCCGCCTTCAAGGA
TCCAACCAAATCCTTGTCTGCAGCGGCTCATCACTGTAGTCGCAGCTACAGTACAGCTCAGACCGATGATTCGAGAGGGA
ATTGGCTAACTTTACCTCCTTTTTCTCCCACCATCGATGGCACCGCCGTAGGAAAGGATCTCCTTTCCGACGGAGACTCC
GTCAAAGCTTCAACGGATAACTCTAAAACGACGGCGCTTAGGTGGATTCTTCGCTGTCGTCCAGATTTACCCAGGACTCT
CGTTCAGAAACTCTTCCGTTTAAGACAGGTGAGAAGACAAATGTCTCTGAGTGTTGATGGTCATGAACTACAAAGAAGCC
AGCTTAAAAGGGTGGCAGCTAAGGAATCCTTGAATGTAGGTGATAGAATTTACCTTCCTTTGTCGGTTGACAATGATACG
CCGCCGACGCCACCTGCTAAGAAAGAAAGCTTTCAATGTAGTGAAGAAGAACGCAAATTTGTTTGCAGTTTGGTGTTATA
TAAGGATCCAGCTATTATTGTTCTGAATAAACCTCATGGTTTGGCTGTTCAAGGTGGGAGTGGGATCAAAACCAGTATCG
ATGAACTCGCTGCCACTTGCTTGACATTTGATAAATCAGAATCTCCCCGGCTGGTGCACCGACTTGACAGAGACTGTAGT
GGACTTTTGGTGTTGGCAAGAACACAGACGGCTGCAACAGTTCTCCATTCCATATTCCGCGAGAAAACATGTGGTGCGTC
CGCATATGGTGTCAAAAAGAACATAAAATCCTTGAAAAGAAAATATATGGCACTTGTGATCGGGTGTCCAAGACGTCAAA
AGGGACAGATTTCAGCGCCACTCAGAAAGGTGGTTGTGGATGATGGAAAATCTGATCGTATCACTGTTAATGACAATGGA
GAACTCGTTTCTACTCAGCATGCTATCACTGAATACAAAGTAATTGAATCTTCACCACATGGATACACATGGCTTGAGCT
TCGCCCTTTAACCGGGAGAAAACATCAGCTTCGTGTACACTGCGCAGAAGTTCTAGGAACACCTATACTCGGGGACTACA
AATACGGTTGGCAAGCTCATAAAGCCCGGGAACCTTTTGTCTCTTCTGAAACCACCCCGACCAAGCCATCATCATCTCCT
TTTGGCCTTGATCTAGACGGTGGAGATGTCTCTTCAAAACAGCCACACCTTCATCTCCATTCAAAGCAAATCGATCTGCC
AAACATATCTCAGCTCTTGGAGAAAATGCAGGTTTCTTCAGATTCTGATATTTCGGATCTCGATAGCCTTAAATTCGATG
CACCATTGCCTAGTCATATGCAGCTAAGCTTTAATTTGTTGAAATCTAGAGTCGAAACTTGTGACAAAAATTAG