Details for Lyrate rockcress Locus 16052751

Position : sca3 ( 5`- 3832296 .. 3834507 -3` )
Annotation : [B2G] alpha beta fold family protein
External links : CoGe
PGDD synteny : 16052751

Protein [Map View]
MEEMPRGVPTWQDEFASLMDGGLQYDGSPIDLTADNESRSKSSGFGSGSGSESVESLKDQVTGFIKSWGEMLLDLAIGCK
DVVQQMVVTEDSFVVRKLRKPAAKVSKKLSFLNDYLPEDRDPVHAWPVIFFVFLLALTALSFCSDHDRSVPVLKKIRLHP
TSASRVLLPDGRYLAYQELGVSADRARHSLIVPHSFLSSRLAGIPGVKESLLKDYGVRLVSYDLPGFGESDPHRARNLSS
SASDMIDLAAALGIVDKFWLLGYSTGSVHVWAAMRYFPDQIAGVAMVAPMINPYEPSMTKEEIAKTWEQWQRKRKFMYFL
ALRWPSLLPFSYRRSFLSGNLEPLDKWMSMSLGEKDKLVITDPVFEDLYQRNVEESVRQGTAKPFVEEAGLQVSNWGFSL
PEFHMQKKCRTNGVLSWLMSMYSESECELIGFRKPVHIWQGMDDRVSPPSVTDYISRVIPEASVHRLPNEGHFSYFYFCD
ECHKQIFSAIFGEPRGSVELSEQRTETHKPDQPKTGLSDSSTTKE*

DNA
ATGGAGGAGATGCCAAGAGGAGTGCCTACGTGGCAAGACGAGTTTGCTAGTCTCATGGACGGAGGTTTACAATACGACGG
ATCTCCGATTGATCTGACGGCGGATAATGAATCAAGGTCAAAGAGTTCGGGTTTCGGGTCGGGTTCTGGATCCGAATCAG
TGGAGAGTTTGAAGGATCAAGTGACGGGGTTTATCAAGTCTTGGGGAGAAATGCTTTTGGATCTCGCAATCGGATGCAAA
GACGTTGTGCAGCAGATGGTGGTGACGGAAGACTCTTTCGTTGTGCGTAAGCTCCGGAAACCAGCTGCTAAGGTTTCTAA
GAAGCTTAGCTTCCTTAACGACTACTTGCCTGAGGATCGTGATCCTGTTCATGCTTGGCCTGTGATTTTCTTCGTCTTCC
TCCTAGCTCTCACAGCATTGAGTTTTTGTTCAGACCATGATAGATCTGTCCCAGTGTTGAAGAAAATCCGTCTGCATCCT
ACCAGTGCAAGCCGTGTACTGCTTCCAGATGGTAGATATTTAGCTTACCAGGAGCTTGGTGTTTCAGCTGACAGAGCTAG
ACACTCTCTAATTGTTCCTCATTCTTTTCTTTCCTCTCGGCTTGCAGGTATACCCGGAGTAAAAGAATCATTGCTCAAGG
ACTATGGTGTCCGTCTAGTGTCATATGATCTTCCAGGGTTTGGAGAGAGTGATCCCCATCGTGCTCGGAACCTTAGCTCA
TCAGCCTCGGATATGATTGACTTAGCTGCTGCTCTCGGGATTGTTGACAAGTTCTGGTTACTCGGCTATTCCACTGGTAG
TGTTCATGTCTGGGCTGCAATGAGATACTTTCCGGACCAAATAGCTGGAGTTGCCATGGTAGCGCCTATGATAAATCCAT
ATGAGCCAAGCATGACAAAGGAAGAGATTGCAAAAACGTGGGAGCAGTGGCAACGAAAGAGGAAATTCATGTACTTCTTA
GCACTTCGGTGGCCAAGTCTTCTTCCTTTCTCATATCGCAGGTCCTTTCTCTCCGGTAATCTCGAGCCGCTGGATAAGTG
GATGTCAATGTCATTAGGAGAAAAGGACAAACTTGTAATCACAGATCCAGTTTTTGAAGATCTTTACCAAAGGAACGTGG
AGGAGTCTGTACGGCAAGGAACTGCAAAACCATTTGTCGAAGAAGCCGGGTTACAGGTCTCAAATTGGGGCTTTAGTCTT
CCCGAATTCCACATGCAGAAGAAGTGTAGAACCAATGGCGTCCTCTCTTGGCTAATGTCAATGTACAGCGAATCCGAATG
TGAACTTATTGGGTTCCGGAAACCCGTACACATATGGCAGGGTATGGACGACCGAGTCAGTCCACCTTCAGTGACTGATT
ACATTAGCCGGGTCATACCAGAAGCATCTGTACATAGACTCCCAAACGAAGGCCACTTCTCTTACTTCTATTTCTGTGAT
GAGTGCCACAAGCAGATCTTTTCGGCCATATTTGGAGAACCAAGGGGCTCGGTAGAGTTATCCGAACAAAGAACGGAAAC
CCATAAACCGGATCAACCAAAGACAGGTCTATCTGACAGTAGCACTACCAAGGAGTAA