Details for Lyrate rockcress Locus 16052717

Position : sca3 ( 5`- 6121592 .. 6118492 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052717

Protein [Map View]
MRLRKKLQFEERKQANQRRVLSDSESVRWLNHAMEKIWPICMEQIASQKILRPIIPWFLDKYRPWTAKKAVIQHLYLGRN
PPLLTDIRVLRQSTGDDHLVLELGMNFLTADDMSAILAVKLRKRLGFGMWTKLHLTGMHVEGKVLIGVKFLRRWPFLGRL
RVCFAEPPYFQMTVKPITTHGLDVAALPGIAGWLDKLLSVAFEQTLVEPNMLVVDMEKFVSPEPGENWFFVDEKEPVAHA
LVEVVEASDVKPSDLNGLADPYVKGQLGAYRFKTKILWKTLAPKWQEEFKIPICTWDSPNILNIEVQDKDRFTDDSLGDC
SVNIAEFRGGQRNDMWLPLQNIKMGRLHLAITVLENEAKLNDDPFEGVTISKEDMWASFASDVTSKGSFSSVVSDKSPRV
PDNMEPINIEGQEETGIWVHQPGTEVSQIWEPRKGKNRCLDNEIRGAGSVRSTASTSPNNESSSTDENQEGKSTMKSVGR
GLKKIGLVFHRNGKKEECHHTGSIEEDIRSPRINLKALNQKDVGVKFIVEDRLSGPLTGRSPKGENFGSEDSQHKGHMKD
VAKSILKHAEKSARHLKHAFSRKGSRKSRDDECSTVSEQDSECQHENSDDESAFSSVQDLGTPRTAKLEGKSVRAGEDDN
VNTSANSKDDSKADISKNKETKINLANLETTYSDARNSFAGAKKVTTPKNRRIEKES*

DNA
ATGAGGTTGAGGAAGAAACTACAGTTTGAAGAGAGGAAGCAAGCTAACCAGAGAAGGGTTCTATCTGATTCTGAATCGGT
GAGGTGGTTGAATCATGCTATGGAGAAGATATGGCCTATTTGTATGGAACAGATTGCATCTCAGAAGATTCTACGTCCGA
TCATACCTTGGTTCTTGGACAAGTATAGACCTTGGACTGCGAAAAAAGCTGTGATACAACACCTCTATTTGGGAAGAAAC
CCGCCTTTGTTGACAGATATAAGGGTGCTTCGGCAATCTACGGGTGATGATCACTTGGTGCTGGAACTTGGAATGAATTT
CCTCACAGCAGATGATATGAGCGCAATACTCGCTGTGAAGTTAAGAAAAAGACTTGGGTTTGGAATGTGGACAAAGTTGC
ATTTGACAGGAATGCATGTTGAAGGAAAGGTGTTGATTGGAGTGAAGTTCCTTCGTCGATGGCCTTTTCTGGGGCGTTTA
CGTGTTTGTTTTGCAGAGCCACCTTATTTCCAAATGACTGTTAAACCAATTACCACTCATGGACTTGATGTTGCTGCGCT
TCCAGGAATTGCAGGATGGCTAGATAAACTTTTGTCTGTCGCATTTGAGCAAACTCTTGTTGAGCCAAATATGCTGGTAG
TTGATATGGAGAAATTTGTTAGCCCAGAGCCAGGAGAAAATTGGTTCTTTGTTGATGAGAAAGAACCAGTAGCACACGCT
CTTGTTGAAGTCGTTGAAGCATCTGATGTTAAACCATCAGATCTAAACGGTTTAGCTGATCCATATGTGAAAGGGCAGCT
TGGCGCTTACAGATTCAAAACCAAGATACTATGGAAAACGTTGGCTCCTAAATGGCAAGAAGAGTTCAAGATACCAATTT
GCACATGGGACTCCCCAAATATCCTTAACATTGAAGTTCAAGACAAAGACCGATTTACCGATGACAGTCTTGGCGATTGT
TCAGTGAACATTGCAGAGTTTCGAGGCGGCCAAAGAAATGACATGTGGTTGCCTCTTCAGAACATTAAAATGGGGAGGCT
GCACCTTGCTATAACCGTACTTGAGAACGAGGCAAAGTTGAACGATGATCCGTTTGAAGGAGTGACAATAAGTAAGGAAG
ACATGTGGGCTTCTTTTGCTTCCGACGTTACAAGTAAAGGTTCCTTCTCATCAGTGGTATCTGACAAGTCTCCAAGGGTT
CCTGATAATATGGAACCAATTAACATCGAAGGACAAGAAGAGACTGGAATCTGGGTACATCAACCAGGAACTGAAGTCTC
ACAGATTTGGGAACCAAGAAAAGGCAAGAATCGATGCCTTGATAACGAAATACGTGGTGCTGGCAGTGTCCGTTCCACTG
CATCTACGTCGCCCAACAATGAAAGCAGCAGCACTGATGAAAATCAGGAAGGGAAGAGCACGATGAAGTCAGTTGGTCGG
GGATTGAAGAAAATCGGTTTAGTGTTCCATAGGAATGGAAAAAAGGAAGAATGTCATCATACAGGGAGCATTGAAGAGGA
TATCAGGTCTCCTCGGATTAATTTGAAGGCGTTAAATCAAAAGGATGTTGGGGTTAAGTTCATCGTTGAAGACAGGCTAT
CGGGGCCTCTCACAGGAAGAAGTCCAAAAGGTGAGAACTTTGGTTCTGAAGACAGTCAGCACAAGGGACACATGAAGGAT
GTTGCGAAGAGCATTCTAAAACATGCTGAAAAGTCTGCAAGACACCTTAAGCATGCTTTTTCGCGTAAAGGATCAAGGAA
ATCAAGAGATGACGAGTGTTCAACTGTGTCAGAGCAAGACTCTGAATGTCAACATGAAAATTCTGATGATGAATCTGCAT
TTAGCAGTGTGCAGGATCTGGGGACACCAAGAACAGCAAAACTTGAAGGAAAATCTGTCAGGGCAGGTGAAGATGATAAT
GTAAATACATCAGCAAACTCCAAGGACGATTCGAAAGCAGACATTTCGAAAAACAAAGAAACAAAGATAAATTTAGCAAA
CTTGGAAACTACATATAGTGATGCCAGGAACTCTTTTGCTGGAGCCAAGAAAGTCACCACCCCCAAGAATCGAAGGATTG
AAAAGGAATCATAG