Details for Lyrate rockcress Locus 16052715

Position : sca3 ( 5`- 1111386 .. 1114655 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052715

Protein [Map View]
MSQQISGNNIPLSEVYWSLVNKADKKFSKIRDLPFYERTRYENYFFKVFKVYTQLWKFQQENRQKLVEAGLKRWEIGEIA
SRIAQLYYGHYMRTSDAGYLSESYVFYEAILTREYFKEGLFQDLNIANKQLRFLARFLMVCLVLGRREMVHQLVDQFKRL
IDECKRTFQETDFKEWKVVAQEIVRFLKSDTAFMNIRPLRYSLVLDPNLDAGTPRASRSLRLTDAILSSYYYNEVKYSEL
TLDSFRMLQCLEWEPSGSLYQSTGAKMGLNAPVGVSRINSQSMNDPTLPPNPRKAVLYRPSITHFLAVLATICEELPSHG
ILLLYLSASGKNGQISSSPLSARSATNVEENILRDFESHTIKQETDPSLQITPSGQSLRQISEDAVSTPCGLSFGSHGLT
GSSYIYPSDLVPFTRKPLFIIIDSDSSTVFKNICGAEKGEPAALLLSPSHTPPLISADFSRQPSGSLFTIFLTSPVQAFC
LLSGISASDMETDILTKAEKLLSSFMNEWASTLATSDTLHPVWSQILKDPFLRRLLLRFIFCRAVLALYTPVFNNKQNQP
ECFPSLPESLVPTAPAVQSAVLLMANVFGATSKFTLPQDITMLESF*

DNA
ATGTCGCAGCAAATCAGCGGTAATAATATCCCGCTGAGTGAAGTTTACTGGTCTCTTGTTAACAAAGCCGATAAGAAATT
CTCCAAGATCAGAGACTTGCCCTTCTATGAACGCACCAGGTATGAAAACTATTTCTTCAAGGTATTCAAAGTATACACAC
AGTTATGGAAGTTTCAGCAAGAAAATCGGCAGAAGCTTGTTGAAGCTGGACTTAAGAGATGGGAGATTGGAGAGATCGCA
TCTCGAATTGCACAGCTTTACTATGGACATTATATGCGGACAAGTGATGCCGGTTACTTATCCGAGTCTTATGTATTCTA
CGAAGCAATACTCACTAGAGAGTACTTCAAAGAAGGATTGTTTCAGGATCTTAATATTGCAAACAAACAGCTACGGTTTC
TTGCAAGGTTTCTTATGGTGTGTTTGGTCCTTGGCCGCCGTGAGATGGTGCATCAACTTGTTGATCAGTTTAAACGGTTG
ATAGATGAATGCAAGAGGACATTCCAGGAAACCGATTTTAAAGAATGGAAGGTGGTGGCGCAGGAAATAGTTAGATTTCT
GAAATCTGACACTGCATTTATGAATATCAGACCTCTAAGATATAGTCTTGTACTGGATCCTAATCTGGATGCTGGTACAC
CGCGTGCAAGTAGATCTTTAAGGTTGACGGATGCAATCTTGAGCAGCTACTATTATAACGAGGTCAAGTATTCGGAGCTC
ACGCTCGATTCTTTTAGGATGCTTCAATGCTTAGAGTGGGAACCGAGTGGTTCACTATATCAATCAACTGGTGCAAAAAT
GGGTCTGAATGCTCCCGTTGGAGTTTCTCGTATTAACTCCCAGAGCATGAATGATCCTACTTTGCCACCTAACCCTCGCA
AAGCTGTCCTTTATCGTCCATCCATAACACATTTTTTGGCTGTTTTGGCCACTATTTGTGAGGAGCTTCCTTCTCATGGC
ATTCTTTTATTATATCTGTCTGCTTCTGGCAAGAATGGACAGATTTCATCATCTCCTTTGAGTGCTAGAAGTGCAACCAA
TGTTGAGGAGAATATCTTGAGAGACTTTGAATCTCACACAATCAAACAAGAGACAGACCCATCACTTCAAATTACCCCAT
CTGGTCAGTCTTTGAGGCAAATCAGTGAGGACGCAGTCAGTACCCCATGTGGTCTGTCTTTTGGCAGTCATGGGCTCACA
GGATCAAGCTACATCTATCCCTCTGATTTAGTTCCATTTACAAGGAAACCTCTTTTCATTATCATTGACAGTGATAGCAG
CACAGTTTTTAAGAATATTTGTGGAGCGGAGAAAGGAGAACCAGCTGCATTGCTTCTGTCTCCATCACATACTCCTCCGC
TTATCTCTGCTGATTTCTCTCGTCAACCTAGTGGTAGCCTTTTCACCATTTTTCTCACGTCACCAGTCCAAGCGTTTTGC
TTGTTAAGTGGGATTTCCGCCTCTGATATGGAAACGGATATCTTAACTAAGGCCGAGAAGCTTCTTTCTTCGTTTATGAA
CGAATGGGCTTCGACATTGGCGACATCAGATACCCTTCACCCAGTTTGGTCACAGATACTAAAAGATCCCTTCTTGAGAC
GACTACTCCTAAGATTCATATTCTGCCGGGCTGTCTTGGCACTGTACACTCCAGTCTTCAATAACAAACAAAATCAGCCA
GAGTGCTTTCCTTCTCTCCCGGAATCGTTAGTACCAACTGCTCCTGCTGTTCAATCCGCTGTGCTTCTGATGGCCAATGT
ATTTGGTGCTACAAGTAAATTTACTCTACCTCAAGATATCACAATGCTCGAAAGCTTCTAA