Details for Lyrate rockcress Locus 16052708

Position : sca3 ( 5`- 3794033 .. 3792600 -3` )
Annotation : [B2G] amine oxidase family protein
External links : CoGe
PGDD synteny : 16052708

Protein [Map View]
MPPLANTLPISSISQFFPPCRGHANHRYRRFSGAQSSTADPYNRKNQTGVIIIGAGLAGLAAANQLTSKRIPFLLLEASD
GVGGRVRTDIVDGFFLDRGFQIFITAYPEAKKLLDYESLDLQRFYAGAKVFYGGKFHTVADPLRHFWDSVASLTNPIGSV
VDKGLIALTRARVLIKSDEEILTAADEVPTIDLLRKIGFSEAILDRFFRPFFGGIFFDRDLETTSKLFDFVFRCLALGEN
TLPTMGIGEISNQLAAKLPANSVLLNTRVASVEYPNGTGSDPPSVRLQDGGVLKAELGVIIAVEQPEVDKLLDGIRDPVI
TKPARSTICLYFTAEPNQIPVQDPVLFLNGTNTGIINNMFFATNVARTYAPPGKALVSVSLIGSFEDRSDDDLAAEVISE
LSGWFGESSVMSWKHLKTYRIQFAQPNQCPPTDLVKNPRVGSGLYLSGDYMTSATFDGALVSGRRAVEVLLREKGLI*

DNA
ATGCCGCCATTGGCGAACACTCTCCCAATCTCATCTATTTCTCAATTCTTCCCTCCCTGCCGCGGCCATGCAAATCACCG
ATATCGACGCTTTTCCGGAGCTCAATCTTCCACGGCAGACCCGTACAATCGGAAGAATCAAACTGGCGTCATCATCATCG
GCGCTGGACTCGCTGGTTTAGCCGCCGCGAACCAGCTCACCTCCAAACGAATCCCTTTCCTACTCCTCGAAGCTTCCGAC
GGTGTCGGCGGACGCGTCCGTACAGATATCGTCGACGGCTTCTTTCTCGACAGAGGATTTCAGATTTTCATCACTGCGTA
TCCCGAAGCTAAAAAGCTTCTAGATTACGAATCACTGGATCTGCAGCGATTCTACGCCGGAGCTAAGGTTTTTTACGGCG
GAAAATTTCACACAGTAGCTGATCCTCTCCGACATTTTTGGGATTCGGTGGCATCTCTCACGAATCCGATTGGATCCGTC
GTGGACAAAGGGCTTATCGCTTTGACGAGAGCTAGGGTTCTAATCAAGTCAGACGAAGAGATATTGACTGCCGCCGATGA
AGTTCCGACCATTGATCTCCTCCGTAAGATTGGTTTCTCAGAAGCGATTCTTGATCGGTTCTTCCGACCATTCTTCGGTG
GAATTTTCTTCGACAGAGACCTCGAGACGACCTCGAAGCTCTTTGATTTCGTTTTCCGGTGTCTTGCTCTCGGAGAAAAT
ACACTTCCAACCATGGGAATCGGAGAAATCTCGAACCAGTTGGCCGCGAAATTACCCGCTAATTCCGTCTTGTTGAACAC
AAGGGTCGCTTCGGTTGAGTATCCAAATGGAACGGGCTCTGATCCACCTAGCGTGAGACTCCAAGACGGCGGCGTTTTGA
AGGCAGAGCTAGGTGTCATAATCGCCGTCGAGCAACCAGAAGTGGATAAGCTTCTCGATGGGATCAGAGACCCGGTTATA
ACAAAACCGGCTCGGAGCACCATTTGTCTTTACTTCACAGCTGAACCAAACCAGATACCGGTACAAGACCCGGTTCTATT
TCTCAACGGGACAAATACCGGTATAATCAACAACATGTTCTTCGCTACAAATGTTGCTCGGACATACGCGCCACCGGGAA
AGGCTCTGGTTTCGGTATCATTGATCGGATCGTTCGAGGATAGATCCGATGATGATTTAGCAGCAGAGGTTATTAGCGAA
CTCTCTGGTTGGTTTGGTGAGTCTTCGGTTATGTCATGGAAACATTTGAAAACGTACCGGATCCAATTCGCTCAGCCTAA
CCAATGCCCACCCACTGATTTGGTTAAGAATCCTCGGGTCGGGTCGGGTCTTTACTTGAGCGGTGATTACATGACTTCTG
CTACATTTGACGGAGCTTTGGTCTCTGGGAGACGAGCCGTGGAAGTTTTGTTACGAGAAAAGGGACTAATCTAA