Details for Lyrate rockcress Locus 16052671

Position : sca3 ( 5`- 6902831 .. 6904245 -3` )
Annotation : [B2G] gdsl-motif lipase hydrolase family protein
External links : CoGe
PGDD synteny : 16052671

Protein [Map View]
MDRCTSSFLLLTLVSALSILQISFAQLVPAIMTFGDSVVDVGNNNYLPTLFRADYPPYGRDFANHKATGRFCNGKLATDI
TAETLGFTKYPPAYLSPEASGKNLLIGANFASAASGYDDKAALINHAIPLYQQVEYFKEYKSKLIKIAGSKKADSIIKGA
ICLLSAGSSDFVQNYYVNPLLYKVYTVDAYGSFLIDNFSTFIKQVYGIGARKIGVTSLPPTGCLPAARTLFGFHEKGCVS
RLNTDAQNFNKKLNAAASKLQKQYSGLKIVVFDIFTPLYELVQNPSKSGFTEATKGCCGTGTVETTSLLCNPKSLGTCSN
ATQYVFWDSVHPSEAANEILATALIGQGFSLLG*

DNA
ATGGATCGTTGCACGTCTTCGTTTTTGCTTCTCACGTTGGTCTCTGCCTTGTCCATTCTCCAAATCTCCTTTGCTCAACT
TGTTCCAGCAATCATGACATTTGGTGACTCTGTAGTTGATGTCGGCAACAACAACTATCTTCCGACCCTTTTCAGAGCTG
ATTATCCTCCTTATGGCCGTGATTTTGCTAACCACAAAGCCACCGGCCGTTTCTGCAACGGCAAATTAGCGACTGATATC
ACCGCTGAGACTCTAGGCTTCACTAAGTACCCACCAGCTTATCTAAGTCCTGAAGCTTCTGGTAAGAATCTTCTCATTGG
TGCTAATTTCGCTTCTGCAGCTTCAGGTTATGATGACAAAGCTGCTCTTATCAATCACGCGATCCCGTTGTATCAGCAAG
TAGAGTATTTCAAGGAATACAAAAGCAAGCTCATAAAAATTGCAGGAAGCAAAAAAGCTGATTCGATCATAAAGGGAGCA
ATCTGTCTCTTAAGTGCAGGAAGCAGTGATTTTGTTCAAAACTACTATGTGAATCCTCTGCTTTACAAAGTTTACACTGT
TGATGCGTACGGATCTTTCCTTATCGATAACTTCTCTACATTTATCAAGCAAGTGTATGGGATTGGAGCAAGGAAGATTG
GTGTGACTTCTCTGCCGCCAACGGGATGTCTTCCAGCTGCAAGAACTCTTTTCGGTTTCCATGAAAAAGGCTGTGTTTCA
AGACTCAACACAGATGCCCAAAATTTTAACAAGAAGCTTAACGCAGCTGCTTCAAAGCTACAGAAGCAATATTCCGGTCT
TAAGATTGTTGTCTTCGACATCTTCACTCCACTCTATGAACTTGTTCAGAACCCTTCCAAATCCGGATTCACGGAAGCAA
CCAAAGGATGTTGTGGAACAGGAACAGTCGAGACAACTTCACTCTTGTGCAATCCGAAATCGTTAGGGACTTGCTCCAAT
GCTACTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTGAAGCTGCCAATGAGATTCTTGCCACGGCGCTAATTGGACA
AGGATTTTCTCTCCTCGGTTGA