Details for Lyrate rockcress Locus 16052668

Position : sca3 ( 5`- 3644193 .. 3646021 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052668

Protein [Map View]
MQTLHQSQLLHNSADAANNQSESDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASQPRHTDMPLQLFLREDAS
MRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRF
FPHIDDGLKMEPSSKKHRASHFLLENGREEPVDYKTLPDIQSRLEKLVPNVKVSTYGRLNWLKRANSLPGSGSDDPTEGS
KPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLNPAGSVDPDAVAFFSPDEGGSYLHARGFSVYHVYKHMTEHA
ATALQYFLGFGTGTALYSLLLWICSFESLFSKPCTKCGRLLAMDKKSALILPPLHRAYQELPLALNLDVCEAYHSSCSQD
DT*

DNA
ATGCAGACGCTACACCAGTCCCAACTTCTCCATAATTCGGCCGACGCGGCGAACAATCAGTCGGAATCTGACGCGCCGCC
GAAACAGGTGGCTCAGGCCATGGAACGACTCAATCAAGCGGCTAGGGTTATCGCCGATATCCGCCTCGGCGCTGACCGTA
TCCTTGAAGCTATGTTCGTGGCTTCGCAACCTCGTCACACAGACATGCCTCTTCAGCTCTTTCTCAGAGAAGACGCCTCC
ATGCGTCAACATCTTCAGGATCTTCGCTTAATCGGGAAGAAATTGGAAGAATCTGGAGTGTTAACTGAATCACTTAGGTC
AAGAAGTAACTCATGGGGTCTTCACATGCCTTTGGTTTGTCCAGATGGTGCTGTCGTTGCTTATGCTTGGAAAAGACAGC
TTGCTGGCCAAGCTGGTGCTTCTGCTGTTGATAGAACCAGGTTAGCTCTCAAGGCCTTCACGGATCAGAAAAGACGATTC
TTCCCTCATATTGATGATGGATTAAAGATGGAACCAAGCTCAAAAAAACATCGTGCCTCCCATTTCCTATTAGAAAATGG
AAGAGAGGAGCCGGTTGATTACAAAACATTACCAGATATACAATCGCGTTTAGAGAAGCTGGTCCCCAATGTGAAGGTCT
CTACTTATGGACGATTGAACTGGCTTAAAAGAGCTAACTCTTTACCTGGGTCAGGTAGTGATGATCCAACAGAAGGATCG
AAACCTATTTTCCAGAGTTCTAGTAAGCTGAGATCAGGGTTACAGACTGAAGTTGTCGATAAGATTGCTGTTATTGAGTT
ATCATTTCCTTCTTTATTCAGAGCTATAGTCTCGTTGAATCCAGCGGGTTCTGTTGATCCAGATGCAGTTGCTTTCTTCT
CCCCAGATGAGGGAGGCAGCTACTTACATGCGCGAGGCTTCTCGGTTTATCATGTTTACAAACACATGACGGAACATGCT
GCTACGGCCTTGCAATATTTCCTCGGCTTTGGTACTGGAACAGCTCTCTACTCTCTTCTGCTATGGATATGCAGTTTTGA
ATCCCTATTTAGCAAACCTTGCACTAAATGTGGAAGGCTATTAGCAATGGATAAAAAGTCTGCGCTAATCTTACCTCCTT
TACACCGCGCTTACCAAGAATTGCCTCTTGCATTAAACCTGGACGTTTGTGAAGCTTACCACTCCAGTTGCTCTCAAGAT
GATACGTAG