Details for Lyrate rockcress Locus 16052665

Position : sca3 ( 5`- 7602354 .. 7604367 -3` )
Annotation : [B2G] dihydroorotate dehydrogenase family protein
External links : CoGe
PGDD synteny : 16052665

Protein [Map View]
MASMSFALNRFSGLSSKTTLSADFDPSTRRSFLPPTRVGLKISSATESEPDLSVTVNGLKMPNPFVIGSGPPGTNYTVMK
RAFDEGWGAVIAKTVSLDAAKVINVTPRYARLRTGSNGSAKTDVIGWQNIELISDRPLETMLKEFERLKKEYPDRILIAS
IMEEYNKTAWEELIDRVEQTGVDALEINFSCPHGMPERRMGAAVGQDCVLLDEVCGWINAKATVPVWAKMTPNITDITEP
ARVSLKSGCEGISAINTIMSVMGVDMKTLRPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAKMMKSEFSENHSLSGIGGV
ETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTLCAELQDFMKQHNFSTIEEFRGHSLQYFTTHTDLVKRQKEAVEQRKA
EKRGLKSDKDWTGDGFVKETESMVSN*

DNA
ATGGCTTCCATGAGTTTCGCCTTGAATCGCTTCTCTGGACTCTCATCTAAAACCACCTTATCAGCTGACTTCGATCCATC
AACTCGCCGAAGTTTTCTACCGCCGACTAGAGTTGGACTTAAGATTTCTTCCGCCACCGAATCGGAGCCTGATCTCAGCG
TCACTGTAAATGGCCTGAAAATGCCCAATCCTTTCGTGATCGGGTCGGGTCCACCGGGTACCAACTACACCGTCATGAAG
AGAGCTTTTGACGAAGGTTGGGGAGCCGTCATCGCCAAAACCGTATCATTAGATGCAGCCAAAGTTATCAACGTGACACC
TCGATATGCTCGGCTACGAACTGGTTCCAATGGCTCAGCCAAAACAGATGTAATTGGGTGGCAGAACATAGAACTCATCA
GTGACCGACCTCTTGAAACCATGCTCAAAGAGTTTGAGCGATTGAAAAAAGAGTATCCTGATCGGATTCTGATTGCTTCC
ATCATGGAGGAATATAACAAAACTGCTTGGGAAGAGCTTATTGACCGTGTTGAGCAAACTGGGGTTGATGCTTTAGAAAT
CAACTTCTCGTGTCCTCATGGTATGCCAGAGCGCAGAATGGGTGCCGCTGTTGGACAAGATTGTGTGCTTCTCGACGAGG
TTTGCGGATGGATTAATGCTAAAGCTACAGTTCCTGTGTGGGCTAAGATGACTCCTAATATCACTGACATAACAGAGCCT
GCTAGGGTATCTCTAAAATCAGGATGTGAAGGAATTTCAGCTATCAATACAATCATGAGTGTAATGGGAGTTGATATGAA
GACGCTGCGTCCTGAGCCATGCGTTGAAGGTTATTCAACTCCAGGAGGCTACTCTTATAAGGCCGTTCGCCCAATTGCGC
TTGCAAAAGTTATGAACATTGCCAAAATGATGAAATCTGAGTTCAGTGAAAATCACTCGCTTTCGGGTATCGGAGGTGTT
GAAACTGGCTATGATGCCGCTGAGTTCATTCTCCTTGGATCAAATACTGTACAGGTATGCACCGGTGTGATGATGCACGG
GTATGGTCATGTGAAAACCCTTTGCGCCGAGCTTCAAGATTTCATGAAACAACACAACTTCTCGACGATAGAAGAGTTCA
GAGGGCATTCGCTGCAGTACTTTACAACACACACAGATTTAGTTAAGAGACAGAAAGAAGCAGTTGAGCAGAGAAAAGCT
GAGAAGAGAGGCTTGAAATCTGATAAAGATTGGACCGGAGATGGGTTCGTGAAGGAGACTGAGAGTATGGTTTCTAACTA
A