Details for Lyrate rockcress Locus 16052644

Position : sca3 ( 5`- 1504468 .. 1501112 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052644

Protein [Map View]
MKVVALVSGGKDSCYAMMKCIHYGHEIVALANLLPVDDSVDELDSYMYQTVGHQIIVGYAECMNVPLFRRRIRGSSRHQK
LSYQMTPHDEVEDMFVLLSEVKRQIPSITAVSSGAIASDYQRLRVESVCSRLGLVSLAFLWKQDQTLLLQEMIANGIKAI
LVKVAAIGLDPSKHLGKDLAFMEPYLLKLKEKYGSNVCGEGGEYETLTLDCPLFTNASIVLDEYQVVLHSPDSIAPVGVL
HPSTFHLEKKGNPDSNSPEEESSLVSEVLGDGPNTSDSTRQRDNGIVDLGEHTSNRLHISKTEKHNTFSICCWLEDSSVS
STGLKEDLETVLTELESQLLKRGYNWQHVLYIHLYISDMSEFAVANETYVKFITQEKCPFGVPSRSTIELPLVQSGLGKA
YIEVLVAIDESKRVLHVQSISCWAPSCIGPYSQATLHKSVLHMAGQLGLDPPTMNLRNEGAIAELNQALTNSEAIAQSFN
CSISLSAILFVVFCSARTKQSERNQLHEKFVTFLDLAKSSRRVRNVLDPMFLYILVPDLPKRALVEVKPILYVEEDTETE
DETSRDQSSEGDYSFWGYKPEKWHQDCVQKRVVDGKMCVTVLSISAELMRKHQGEEEQLERVSRFCVYLLNKTLSENSFS
WQDMTSLRIHFSTSLGVSVETLSDIFASAFRELNEMSGVKVGSSKEPIFNLVPVLGAGNSCASLDNIITCELFALRS*

DNA
ATGAAGGTCGTGGCTTTAGTGAGTGGAGGCAAAGATAGCTGTTATGCTATGATGAAGTGTATCCACTACGGTCACGAGAT
CGTGGCATTGGCTAATTTGTTGCCGGTTGATGATTCCGTCGATGAATTGGACAGCTATATGTATCAAACTGTAGGCCACC
AGATTATAGTGGGTTATGCAGAATGTATGAATGTGCCATTGTTCAGAAGAAGAATCCGAGGATCTTCAAGGCATCAGAAA
CTTAGCTACCAAATGACTCCACATGATGAAGTGGAAGATATGTTTGTCTTGTTAAGTGAAGTGAAGAGACAGATACCTTC
CATCACTGCAGTATCGTCTGGTGCCATTGCATCAGACTACCAACGACTGCGTGTGGAGAGTGTTTGTTCAAGGTTAGGCC
TTGTTTCTTTGGCATTTTTGTGGAAACAAGATCAGACATTGCTTCTTCAGGAAATGATAGCAAATGGGATAAAAGCTATT
TTAGTCAAGGTCGCGGCAATAGGGTTAGATCCCTCAAAGCATTTAGGGAAAGACTTAGCCTTCATGGAACCATATCTTTT
GAAGTTAAAAGAGAAGTATGGAAGTAATGTATGCGGTGAAGGAGGAGAATATGAAACTCTGACTCTAGATTGCCCGCTTT
TCACTAATGCGAGTATCGTGCTTGATGAATATCAAGTTGTGCTACACTCTCCAGATTCCATTGCACCTGTTGGTGTTCTT
CATCCATCTACGTTCCATCTTGAAAAGAAAGGGAATCCAGACTCCAATTCCCCTGAAGAGGAATCGAGTTTAGTGTCTGA
GGTACTAGGAGATGGTCCTAACACATCAGATTCTACTCGCCAACGAGATAATGGAATCGTTGATCTAGGTGAACACACAA
GTAACAGACTTCACATATCAAAGACTGAGAAACACAACACATTCTCCATCTGCTGCTGGTTGGAAGATTCTAGTGTATCG
TCAACAGGTCTGAAAGAAGATCTCGAGACTGTTCTTACAGAACTTGAATCCCAGCTTTTAAAACGCGGGTATAACTGGCA
GCATGTATTGTACATTCATCTTTATATCTCTGACATGAGTGAATTTGCTGTGGCGAATGAGACATATGTGAAATTTATCA
CACAAGAGAAGTGCCCTTTCGGTGTTCCTTCCCGTAGTACAATAGAACTTCCTTTGGTACAATCGGGTCTTGGAAAAGCT
TACATCGAGGTTTTAGTTGCGATTGACGAAAGCAAAAGAGTTCTCCATGTACAAAGTATATCTTGCTGGGCACCTAGCTG
CATTGGACCTTACAGTCAGGCCACTTTGCACAAAAGTGTTCTTCACATGGCTGGACAATTAGGACTTGACCCTCCCACGA
TGAATCTTCGAAACGAAGGCGCAATTGCTGAGCTAAATCAAGCATTGACGAACAGTGAGGCAATAGCACAGTCTTTTAAT
TGCTCAATCTCTTTATCAGCTATACTCTTTGTGGTTTTCTGTTCAGCACGCACAAAACAATCAGAGAGGAACCAACTTCA
TGAAAAGTTTGTTACTTTCTTGGATTTGGCAAAGTCTTCTCGGAGGGTACGGAATGTCCTCGATCCTATGTTCCTTTACA
TCCTTGTCCCCGATCTTCCGAAAAGGGCTCTTGTTGAAGTGAAACCTATTTTATACGTGGAAGAAGATACGGAAACTGAA
GATGAAACCAGCCGAGATCAATCGAGTGAAGGAGATTACAGTTTTTGGGGATATAAGCCAGAGAAATGGCACCAAGATTG
TGTGCAGAAACGAGTTGTTGATGGGAAAATGTGTGTGACTGTTCTCTCTATCTCAGCCGAACTAATGAGGAAACATCAGG
GAGAAGAAGAACAACTGGAGAGAGTATCAAGATTCTGTGTATATCTTCTCAACAAAACCTTGTCTGAAAATTCATTTTCT
TGGCAAGACATGACGAGCTTAAGAATACACTTCTCTACTAGTCTTGGTGTGTCCGTAGAGACATTATCGGACATTTTTGC
GTCTGCATTCAGAGAGCTTAACGAGATGAGTGGAGTAAAAGTCGGCAGCTCGAAAGAACCTATCTTCAATCTCGTCCCTG
TCCTAGGTGCTGGAAACTCTTGTGCTTCACTCGACAACATAATCACCTGTGAACTATTTGCCCTAAGGTCGTAG