Details for Lyrate rockcress Locus 16052641

Position : sca3 ( 5`- 6433314 .. 6433747 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052641

Protein [Map View]
MASASSSAARSLIRDGKSVANLLLRGRTTNLTETVQNNGPAIRSLLWFNQTAPAASQYPVFSETFPVMQSGLRVGFVQKE
GFSERIGKMEAAHGKRVVDNEDADSEEETDFDEEEIDDVDIDDDEDFDDIDDDEEEEDDKYTRK

DNA
ATGGCTTCAGCTTCATCATCGGCGGCGAGATCACTCATCCGTGACGGAAAATCAGTGGCGAATCTACTCCTCCGTGGACG
TACGACCAATCTTACTGAGACTGTGCAGAACAATGGACCGGCCATTCGATCTCTGCTTTGGTTTAACCAGACGGCGCCGG
CGGCTAGCCAATACCCTGTTTTCTCTGAAACTTTTCCGGTTATGCAATCCGGTTTACGTGTCGGCTTCGTTCAGAAGGAG
GGTTTCTCGGAGAGGATAGGGAAAATGGAGGCGGCTCATGGAAAGCGAGTGGTGGACAACGAGGACGCTGATTCAGAGGA
GGAGACAGATTTTGATGAGGAAGAAATTGATGACGTGGATATCGACGACGATGAAGATTTTGATGATATTGACGATGATG
AGGAAGAGGAGGATGACAAGTACACAAGGAAGAA