Details for Lyrate rockcress Locus 16052634

Position : sca3 ( 5`- 3719018 .. 3723647 -3` )
Annotation : [B2G] rna polymerase ii transcription factor
External links : CoGe
PGDD synteny : 16052634

Protein [Map View]
MVWCNHCVKNVPGIRPYDGALACNLCGRILENFNFSTEVTFVKNAAGQSQASGNIVSSVQSGIPSSRERRYRIARDEFTN
LRDALGIGDERADVIDMAVLFFKSAVEQNFTKGRRTELVQASCLYLTCRELNVPFLLIDFSSYLRVSVYELGSVYLQLCE
MLYIADNQNYEKLVDPSIFIDRFSNILLKGTHNKAVVKTAIAIIASMKRDWIQTGRKPSGICGAALYTAALSHGIKCSKS
DIVNIVHICEATLTKRLIEFGNTESGNLNVDEITERESHKRSSTMKPTSNKEAVLCMHQDSKPFGYGLCKDCYEDFINVS
GGLVGGSDPPAFQRAENERMEKAAREENEGGISSLNHDEQLYSDYCSMSKSEKLFSEKGERNKDGDEEHADTSDESDNFS
DISDDEVDGYINNEEETHYKTITWTEMNKDYLEEQAAKEAALKAASEALKASNSNCPEDARKAFEAAKADAAKSRKEKQQ
KKAEEAKNAAPPATAMEAVRRTLEKKRLSLVINYDVLEELFDTSTAEKSPKRSKTETDIEKKKEVKSNEHEKGENEDEAE
EDEEEGSVESYDMNTDFQNGEKFYEEDEGEEEDGNDFGLY*

DNA
ATGGTGTGGTGTAACCACTGCGTGAAGAATGTTCCCGGAATACGCCCTTATGATGGTGCATTGGCATGTAATTTATGTGG
GAGGATATTGGAGAACTTCAATTTTTCTACAGAAGTTACATTCGTTAAGAATGCTGCTGGACAGAGCCAAGCCTCAGGTA
ACATAGTGAGCAGTGTTCAAAGTGGGATTCCAAGCTCACGTGAAAGGAGATATAGAATAGCTAGAGATGAGTTTACGAAT
TTGAGAGATGCATTGGGAATTGGTGATGAGAGAGCTGATGTGATTGACATGGCTGTTCTATTCTTTAAATCGGCAGTTGA
GCAGAATTTCACTAAAGGCCGCAGAACTGAACTAGTACAGGCTTCCTGTCTCTACTTGACTTGCAGGGAATTGAACGTTC
CGTTTCTTCTTATTGATTTCTCAAGCTACCTTCGAGTTAGCGTTTATGAGTTAGGTTCTGTGTACTTGCAACTCTGTGAA
ATGCTGTACATTGCGGATAATCAAAATTATGAAAAGCTTGTTGACCCTTCAATTTTCATCGATCGATTCTCAAACATCTT
ATTGAAAGGAACACATAATAAAGCTGTTGTGAAAACAGCTATAGCCATTATAGCTAGTATGAAGCGAGATTGGATACAGA
CCGGCCGGAAGCCTAGTGGAATATGTGGAGCAGCACTTTACACAGCTGCCCTTTCTCATGGTATCAAGTGCTCTAAGTCA
GATATTGTAAACATTGTGCATATATGTGAAGCAACTCTAACCAAACGATTGATTGAGTTTGGAAATACGGAGTCTGGAAA
TTTAAATGTTGATGAGATCACAGAAAGAGAATCTCATAAAAGATCTTCTACCATGAAACCAACCTCAAACAAAGAGGCGG
TGCTCTGTATGCATCAGGATAGTAAACCTTTTGGTTATGGACTATGTAAAGACTGCTACGAAGATTTCATAAATGTTTCT
GGTGGACTTGTTGGTGGGTCCGACCCTCCTGCTTTCCAGCGCGCAGAGAATGAGCGAATGGAAAAAGCAGCTAGAGAAGA
AAACGAGGGAGGAATTAGTAGCCTAAACCACGATGAACAACTATATTCAGACTATTGCAGTATGAGCAAAAGCGAAAAAC
TATTTTCTGAGAAAGGTGAAAGAAATAAAGATGGGGATGAAGAACATGCTGATACTTCGGATGAATCTGACAACTTTTCT
GACATCAGTGATGATGAGGTAGATGGCTATATCAACAACGAGGAGGAAACGCACTATAAGACGATCACATGGACAGAAAT
GAACAAAGATTATCTTGAGGAGCAAGCCGCTAAGGAAGCAGCTCTGAAGGCGGCTAGTGAAGCTTTAAAAGCTAGCAACT
CTAATTGCCCAGAAGATGCAAGAAAGGCTTTCGAAGCTGCCAAAGCTGATGCGGCAAAATCTAGAAAGGAAAAGCAACAA
AAAAAAGCTGAGGAAGCAAAGAACGCGGCTCCCCCAGCCACAGCAATGGAAGCGGTTCGCCGAACGCTTGAGAAAAAGAG
ACTAAGTTTGGTGATCAATTACGATGTTTTGGAGGAGCTATTTGATACATCCACAGCTGAGAAATCACCCAAGAGGTCGA
AAACCGAGACAGACATTGAGAAGAAGAAGGAAGTGAAGAGCAATGAACATGAGAAAGGTGAAAATGAAGATGAAGCTGAA
GAGGATGAAGAAGAAGGCAGTGTAGAATCATACGACATGAACACAGATTTTCAAAACGGGGAGAAATTCTATGAAGAGGA
CGAGGGAGAAGAAGAGGATGGTAATGACTTTGGATTGTATTGA