Details for Lyrate rockcress Locus 16052611

Position : sca3 ( 5`- 2755606 .. 2755424 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052611

Protein [Map View]
MEMLLKYARSNLLAVKYLEYAFQVETYTLSKANNLLLNVDGAIRYLFSNLLGRSRIRMFT*

DNA
ATGGAGATGCTTCTGAAATATGCACGGTCTAATCTCCTTGCTGTGAAGTACTTGGAATACGCATTCCAAGTAGAGACTTA
CACTCTCTCTAAAGCCAACAACCTCCTACTCAACGTCGACGGAGCCATTAGATATCTCTTCTCGAACCTTCTTGGCAGGA
GTAGGATCAGGATGTTCACTTAG