Details for Lyrate rockcress Locus 16052582

Position : sca3 ( 5`- 2813616 .. 2813335 -3` )
Annotation : [B2G] 60s ribosomal protein l29
External links : CoGe
PGDD synteny : 16052582

Protein [Map View]
MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNIKSGENASAEE*

DNA
ATGGCAAAGTCAAAGAATCACACGGCGCACAATCAGTCTGCCAAGGCGCATAAGAACGGAATCAAGAAGCCAAGGAGGCA
CCGTCACACCCCAACCAGAGGAATGGATCCTAAGTTCCTAAGGAACCAGAGGTACGCAAGGAAGCACAACATCAAGAGTG
GCGAGAATGCTAGCGCTGAAGAGTAG