Details for Lyrate rockcress Locus 16052554

Position : sca3 ( 5`- 2868889 .. 2870007 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052554

Protein [Map View]
MVELKDQDMGEGMQCIRHPYTKNPGGICALCLQEKLGKLVTSSFPVPKPNHLSSSSPKSFTPSTTSSLALSLSSASNGRD
STSNNNLPFLLAKKKKNMLAASSSSSSSSSSSSSANLIYKRSKSTAAAYGESFSQRKRSGFWSFLHLYSSKHQISNTTKK
VDNFSHSRRNQRTESTTETSSKRVGGGGGIDVIVEEEDESPPNKVVSETPTNGGIGGGGGSSFGRKVLRSRSVGCGSRSF
SGDFFERISNGFGDCALRRIESQREATKVISNGGGGEAANAMNEMVKCGGIFGGFMIMTPSSTSSSTTSSTVDHHHNHKM
GNRNWGWAFASPMRAKATTTTHRGRTITESSADNKNISPNLDSIPSLLALKS*

DNA
ATGGTGGAGCTCAAAGATCAAGACATGGGAGAAGGTATGCAATGCATAAGACATCCTTACACAAAGAACCCAGGTGGGAT
CTGTGCTTTATGTCTCCAGGAAAAGCTTGGTAAGCTCGTCACTTCCTCTTTCCCTGTTCCAAAACCCAACCATCTCTCTT
CTTCTTCTCCTAAATCCTTCACTCCTTCCACCACATCATCTCTCGCTCTGTCTCTCTCATCGGCAAGCAATGGCAGAGAC
TCCACCAGCAACAACAATCTCCCGTTTCTTCTGGCTAAGAAGAAGAAGAACATGCTCGCAGCTTCTTCTTCATCTTCTTC
TTCCTCCTCTTCGTCTTCTTCGGCTAATCTTATCTACAAGAGAAGCAAATCGACTGCTGCTGCTTATGGTGAGAGTTTCA
GCCAAAGGAAACGAAGTGGGTTCTGGTCGTTTCTTCACCTCTACTCTTCAAAACATCAGATCAGCAACACCACCAAAAAA
GTCGATAACTTTAGCCATTCAAGGAGGAACCAGAGAACAGAGTCAACAACAGAGACTTCTTCGAAGAGGGTCGGTGGTGG
TGGAGGCATTGATGTGATAGTTGAGGAAGAAGATGAGAGTCCTCCTAACAAAGTGGTTTCAGAAACGCCAACGAATGGTG
GTATAGGTGGTGGTGGTGGTTCGTCTTTTGGGAGGAAAGTGTTGAGATCTAGATCTGTTGGTTGTGGAAGTAGAAGCTTC
TCTGGTGATTTCTTTGAGAGGATCTCTAATGGGTTTGGTGATTGTGCCTTGAGAAGGATTGAGTCACAGAGAGAAGCCAC
CAAGGTCATTAGTAATGGTGGTGGTGGTGAAGCAGCAAATGCGATGAATGAAATGGTCAAATGTGGTGGCATCTTTGGTG
GGTTTATGATAATGACACCATCATCTACATCATCATCAACAACATCATCAACGGTTGATCATCATCATAATCATAAGATG
GGGAACAGAAACTGGGGATGGGCTTTTGCAAGTCCAATGAGAGCCAAAGCTACTACTACTACTCATAGAGGTCGTACCAT
TACAGAGTCTTCAGCTGACAACAAGAACATATCTCCAAATTTGGACTCAATTCCTTCATTGTTGGCTTTGAAAAGCTGA