Details for Lyrate rockcress Locus 16052529

Position : sca3 ( 5`- 543069 .. 525686 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052529

Protein [Map View]
MADDLANLCRFLFDDTAFPSLSSSASSDLFSRRLRSDDSIKRGLRSFYLLLRWGIAPIDDSSGQLRFQTWSDSQVQALVS
ISQAILLLSRSLLGTDLTLNSLNQGLVDQLEPIVLGVIQAVMEFSLSFLEKSSFRQNDLKMEINMEILLEVASFDGSEKQ
YDILPAVSPAEVAELWPAFSGEHDNMEIHSLVKCTFQGGRCSNEEKPVDRLLITLMSECIESDVQAQSVIKPSFQQDCGD
LNPLTRHLAVVHLGCVCRLIMVCKELVQLPNVLDEKTVDQAFLDKLSFCLRILKLLGSLSKDVQSIENDGSLLQAVASFT
DAFPKLFRVFFDFTNHIATEGNIESLSLALVEGFLNLVQLIFGKSSVFQNVQACVAASIVSNLDSSVWRYDVSSCNLTPP
LAYFPRSVIYTLKLIQDLKRQPYHIQDLRVLESEVTYDDASSTVDSVYFHLRQENIPLLKCFTVEDIMRVIFPSSSQWMD
NFFHLVYFLHHEGVKLRPKVERTYSSLRSNSFAEVESQISHDDEALFGNLFSEGSRSLCSIEPNDQPPVSVSSNLPLQAA
KELLNFLRACVFCQEWVPSIYEDGCKKLDAGHIDILLNIVGCSIEDKASDGGCMLQDEGRPGHVAFELLLNLLRSRALSD
FLESYLFQQILVVENSDFNYNDKTLALLAHTLLCRPGLAGAPLRDKIYDGFVSFVAERARGICAEALSLKELTACLPSAF
HIEILLMAFHLSNEAEKAKFSNLIASCLQKVDTPSGICDGPQLSSWAILISRLLVLLHHMLLHPNTCPTSLMLDLRSKLR
EVRSCGSNLHVTVGDHLSSWVSLVARGITDSWTEDESVSHLMSQMIDFSPHPPTFQNDVSAAKTLNLDYGDLSASLSRVL
GLWKGKKAGKVEDLIVERYIFMLSSDIARINCALDSQPSLHVNYQNVDISSSVDLICTSHLLVGDINVVGRNIELRNILI
GVLNQLQAAPEQVVEDLGFDFIREGAWLSLLLYFLDGGVWDYCKKNSCSEIYPFWRECTSVDAKYVAAAEGVVSYLMETG
DIAELLRMLSSLVGKYLRVYKKAFLATFSAWNHHGHSSPSLLLLKHTQFGKSLQGEYAKIGDNSLHLQCIFYLSKLDALG
DGRGSGVLWKVFWEFMVHGFPTSLQTSSAILLSCILSIRCIVLTIDGLLKLGNSKEKFGADTSVLHQLLDSIMIIKFDQV
FESFHGKCEEIHQNICAVLQLPDLTELFLMKDMEGFVRDISAEQIDRSHVLEGVIIKIVDVMDSLSKDSSKSDIFKFYLG
GDAVSEHTREFYELQRGDLSVFIDSLDYCSLEPVNIKVLNFLVDLLSVAQSPDLRRRVQQKFIDMDLVSLSGWLERRLLG
SFVEEIDGKKTAKGNSLPFREAAMNFINCLVSSTNDLHPRELQNHLFEALLISLDSAFLSFDIHMSMSYFHFVLQLARED
NLMKMVLKRSIMLMEKLAADEKLLPGLKFLFGVIGTLLSNRSPSHGESLCGKSLASYKNTATGPLVPKLSGTTKKSDTLA
LPVDQEGSSISLECDVTSVDEDEDDGTSDGEVASLDKEDEEDANSESYLASKVCTFTSSGSNFMEQHWYFCYTCDLTVSK
GCCSVCAKVCHRGHRVVYSRSSRFFCDCGAGGVRGSSCQCLKPRKFNGNGSAPARGTNNFQSFLPLSEDADQLAESDSDV
EEDGFGEENHVVLSIPKETQYKMSLLLEELGIEDRVLELFSSLLPSITSKRDSGLSKDKQVNLGKDKVLSFDKDLLQLKK
AYKSGSLDLKIKADYTNSKDLKSLLANGSLVKSLLSVSVRGRLAVGEGDKVAIFDVGQLIGQATIAPINADKANVKPLSR
NIVRFEIVHLAFNPVVENYLAVAGLEDCQILTLNHRGEVIDRLAVELALQGAFIRRIDWVPGSQVQLMVVTNKFVKIYDL
SQDSISPTQYFTLPNDLIVDATLFVASRGRVFLLVLSEQGNLYRFELSWGGNAGATPLKEIVQIMGKDVTGKGSSVYFSP
TYRLLFISYHDGSSFMGRLSSDATSLTETSGMFEEESDCKQRVAGLHRWKELLAGSGLFICFSSVKSNAALAVSLRGDEV
CAQNLRHPTGSSSPMVGITAYKPLSKDNVHCLVLHDDGSLQIYSHVRSGVDADSNFTAEKVKKLGSKILNNKTYAGAKPE
FPLDFFERAFCITADVRLGSDAIRNGDSEGAKQSLASEDGFIESPSPMGFKISVSNPNPDIVMVGIRMHVGTTSASSIPS
EVTIFQRSIKMDEGMRCWYDIPFTVAESLLADEDVVISVGPTTSGTALPRIDSLEVYGRAKDEFGWKEKMDAVLDMEARV
LGHGLLLPGSSKKRALAQSASMEEQVIADGLKLLSIYYSVCRPRKEVVLSELKCKQLLETIFESDRETLLQTAACRVLQS
VFPRKEIYYQVKDTMRLLGVVKVTSILSSRLGISGTGGSIVEEFNAQMRAVSKIALTRKSNFSVFLEMNGSEVVDNLMQV
LWGILESEPLDTPTMNNVVMSSVELIYSYAECLASQGKDTGVHSVAPAVQLLKTLILFPNESVQTSSRCVLVLAISSRLL
QVPFPKQTMLTTDDLVDNVTTPSVPTRTAGGNTHVMIEEDSITSSVQYCCDGCSTVPILRRRWHCTVCPDFDLCEACYEV
LDADRLPPPHTRDHPMTAIPIEVESLGADTNEIQFSADEVGISNMLPVITSSIPQASTPSIHVLEPGESAEFSASVTDPI
SISASKRAVNSLILSEFLQELSGWMETVSGVQAIPVMQLFYRLSSAIGGAFMDSSKPEEISLDKLIKWLLGEINLSKPFA
ASTRSSFGEIVILVFMFFTLMLRSWHQPGSDGSSSKLGGSTDIHDRRSVQSSTVVATQSSLDVQERDDFASQLVRACSCL
RNQEFVNYLMNILQQLVHVFKSRAANVEARGSSAGSGCGAMLTVRRDLPAGNYSPFFSDSYAKAHRADIFVDYHRLLLEN
VFRLVYTLVRPEKQEKMGEKEKVYRNASSKDLKLDGFQDVLCSYINNPHTGFVRRYARRLFLHLCGSKTQYYSVRDSWQF
SNEVKNLYKHVEKSGGIENNVSYERSVKIVKSLSTIAEVALARPRNWQKYCLRHGDFLSFLLNGVFHFAEESVIQTLKLL
NLAFYQGKDVSSSVQKAEATEVVTGSNRSGSQSVDSKKKKKGEDGHDSGLEKSYVDMEGVVDIFSAKGGDLLRQFIDFFL
LEWNSSSVRTEAKSVIYGLWHHGRHSFKESLLAALLQKVRYLPAYGQNIVEYTELVSLLLGKAPENNSKQAINELVDRCL
NPDVIRCFFETLHSQNELIANHPNSRIYSTLSNLVEFDGYYLESEPCVACSSPDVPYSKMKLESLKSETKFTDNRIIVKC
TGSYTIQSVTMNVHDARKSKSVKVLNLYYNNRPVSDLSELKNNWSMWKRAKSCHLSFNQTELKVEFPIPITACNFMIELD
SFYENLQALSLEPLQCPRCSRPVTDKHGICSNCHENAYQCRQCRNINYENLDSFLCNECGYSKYGRFEFNFMAKPSFIFD
NMENDEDMKRGLAAIESESENAHKRYQQLLGFKKPLLKIVSSIGETEMDSQHKDTVQQMMASLPGPSCKINRKIALLGVL
YGEKCKAAFDSVSKSVQTLQGLRRVLMSYLHQKNSNFSSGASRCVVSKTLNNCYGCATTFVTQCLEILQVLSKHPRSRKQ
LVAAGILSELFENNIHQGPKTARAQARAALSTFSEGDLNAVNELNNLVQKKIMYCLEHHRSMDIALATREEMLLLSEVCS
LTDEFWESRLRLVFQLLFSSIKLGAKHPAISEQIILPCLKIISVACTPPKPDTAEKELTMGKSTPAVQEKDESAAGIIKY
SSESEENNPNVSQKTRDIQLVSYLEWEKGASYLDFVRRQYKASQSIRGASQKSRTHRSDFLALKYTLRWKRRSSRTSKGG
LQAFELGSWVTELILSACSQSIRSEMCTLISLLAAQSSPRRYRLINLLIGLLPATLAAGESSAEYFELLFKMIETQDALL
FLTVRGCLTTICKLISQEVGNIESLERSLQIDISQGFTLHKLLELLGKFLKVPNIRSRFMRDNLLSHVLEALIVIRGLIV
QKTKLINDCNRLLKDLLDGLLLESSENKRQFIRACVSGLQTHAEEKKGRTCMFILEQLCNLICPSKPEAVYMLILNKSHT
QEEFIRGSMTKNPYSSAEIGPLMRDVKNKICQQLDLLGLLEDDYGMELLVAGNIISLDLSIAQVYELVWKKSNQSSTSLT
NSALLASNAAPGRDCPPMTVTYRLQGLDGEATEPMIKELEEDREESQDPEIEFAIAGAVREYGGLEILLDMIKSLQDDFK
SNQEEMVAVLDLLNHCCKIRENRRALLRLGALSLLLETARRAFSVDAMEPAEGILLIVESLTLEANESDSISAAQSALTV
SNEETGTWEQAKKIVLMFLERLSHPSGLKKSNKQQRNTEMVARILPYLTYGEPAAMEALIEHFSPYLQNWSEFDQLQQRH
EENPKDDSIAQQAAKQRFTVENFVRVSESLKTSSCGERLKDIVLENGIIAVAVKHIKEIFAVTGQTGFKSSKEWLLALKL
PSVPLILSMLRGLSMGHLPTQTCVDEGGILTLLHALEGVSGENDIGARAENLLDTLADKEGKGDGFLGEKVRALRDATKD
EMRRRALRKREELLQGLGMRQELSSDGGERIVVSQPILEGFEDVEEEEDGLACMVCREGYKLRPSDLLGVYSYSKRVNLG
VGNSGCARGECVYTTVSYFNIIHFQCHQEAKRADAALKNPKKEWEGAMLRNNESLCNSLFPVKGPSVPLAQYLRYVDQYW
DNLNALGRADGSRLRLLTYDIVLMLARFATGASFSADCRGGGRDSNSRFLPFMFQMARHLLDQGGPVQRANMARSVSSYI
SSSSTSTATAPSSDSRPLTPGSQLSSTGTEETVQFMMVNSLLSESYESWLQHRRVFLQRGIYHTFMQHAHGRVATRAAEP
TSSGGKTQDAETLTGDELLSIVKPMLVYTGMIEQLQQLFKPKKPVHIEPIKKEGTSSGVELEPWEIVMKEKLLNVKEMVG
FSKELISWLDEINSATDLQEAFDIVGVLADVLSEGFTQCDQFVRSAIDKD*

DNA
ATGGCAGATGACTTGGCGAATCTCTGCCGATTTCTCTTCGACGACACCGCCTTTCCCTCTTTGTCGTCTTCGGCATCTTC
AGATCTCTTTTCTCGCCGTTTACGCTCCGATGATTCGATCAAGCGCGGTCTCCGTTCTTTCTATCTCCTCCTTCGCTGGG
GTATCGCTCCGATCGATGATTCCTCTGGCCAGCTACGCTTTCAGACATGGTCCGATTCGCAGGTTCAAGCACTTGTTTCG
ATATCTCAAGCGATCCTTCTACTATCGCGATCTCTTTTAGGTACTGACTTGACGCTGAATAGTTTAAATCAAGGTTTAGT
GGACCAACTCGAACCAATCGTTTTGGGTGTCATCCAGGCGGTGATGGAATTCTCTCTCAGCTTCTTGGAAAAGTCAAGTT
TTAGACAAAATGATCTGAAAATGGAGATAAACATGGAAATACTTTTGGAAGTTGCTTCTTTTGATGGAAGTGAGAAGCAA
TATGATATATTACCGGCTGTCTCTCCCGCCGAAGTTGCAGAACTGTGGCCAGCGTTTTCTGGCGAGCATGATAATATGGA
AATACATAGCCTCGTGAAATGTACTTTTCAAGGGGGCAGATGCTCAAATGAAGAGAAGCCAGTTGACCGGCTTCTTATTA
CGCTGATGTCTGAATGCATTGAATCTGATGTCCAGGCGCAGTCAGTAATAAAGCCCTCTTTTCAACAAGACTGTGGAGAC
CTGAATCCCTTAACTCGACACCTGGCTGTTGTTCACCTTGGCTGTGTTTGTCGTCTGATTATGGTCTGCAAAGAGCTTGT
TCAGTTGCCAAATGTGTTAGATGAGAAGACGGTTGATCAAGCTTTCCTTGATAAATTGTCCTTCTGCTTAAGAATTTTGA
AGCTGCTTGGGAGTCTTTCTAAAGATGTTCAAAGTATTGAAAATGACGGCTCATTGTTACAAGCAGTAGCTTCATTTACA
GATGCTTTTCCTAAGCTGTTTAGGGTTTTCTTTGATTTCACTAACCACATTGCTACAGAGGGTAATATTGAGAGTCTTTC
TCTTGCGCTAGTGGAGGGATTTCTCAATCTCGTCCAACTCATTTTTGGCAAGAGCAGTGTTTTTCAGAATGTCCAGGCAT
GTGTGGCAGCTTCTATTGTGAGCAATCTAGATTCCTCAGTGTGGAGATATGATGTGTCCTCTTGTAATTTGACACCTCCA
CTTGCTTACTTCCCTCGGTCTGTCATCTACACATTGAAACTCATTCAAGATCTCAAGAGACAACCATACCATATCCAAGA
TCTGAGGGTTTTAGAGTCTGAAGTCACCTATGACGATGCCAGTTCCACTGTTGATTCTGTTTATTTCCATCTGCGCCAGG
AAAACATCCCGTTGCTCAAGTGCTTCACGGTCGAGGATATAATGAGAGTGATATTTCCTTCATCAAGTCAATGGATGGAT
AACTTCTTCCATCTTGTTTATTTCCTCCATCACGAAGGAGTAAAATTACGACCAAAAGTTGAGAGGACGTATTCCAGTTT
AAGATCCAACAGTTTTGCAGAAGTTGAAAGCCAAATTTCTCATGACGATGAAGCCCTGTTTGGAAATTTGTTTTCTGAGG
GTAGTCGTTCTCTGTGTTCCATAGAACCAAATGATCAACCACCTGTTTCTGTCAGCAGCAATTTACCATTGCAAGCTGCT
AAGGAACTGTTGAATTTTCTTAGAGCGTGCGTTTTTTGTCAAGAATGGGTTCCTAGTATATACGAAGATGGATGTAAAAA
GCTTGACGCTGGTCACATTGATATCCTGCTCAATATAGTAGGCTGTAGTATTGAAGACAAGGCTTCTGATGGTGGTTGCA
TGCTCCAAGATGAGGGAAGACCTGGACATGTTGCTTTTGAGCTGTTACTCAATCTCTTGAGAAGTCGTGCTCTGTCTGAT
TTTCTAGAGTCCTACCTTTTTCAGCAAATTCTTGTTGTCGAAAATAGTGACTTCAACTATAATGATAAGACTCTGGCACT
GTTGGCTCACACTCTTCTTTGTAGGCCGGGGTTGGCTGGGGCACCGTTGAGAGACAAAATTTATGATGGTTTCGTTAGTT
TTGTTGCCGAGAGAGCAAGAGGTATATGTGCTGAAGCTTTGAGTCTCAAGGAGTTGACTGCGTGTCTTCCCTCTGCTTTC
CATATTGAGATTCTTCTTATGGCTTTCCATTTATCAAATGAAGCTGAAAAGGCAAAATTCTCAAATCTCATTGCTTCATG
TCTACAGAAAGTTGATACCCCGTCAGGAATATGTGATGGTCCTCAGCTGTCCTCTTGGGCAATACTGATATCTAGGTTGT
TGGTGCTGTTGCACCATATGTTGTTACATCCAAACACATGCCCAACATCATTAATGCTAGATCTAAGGTCTAAACTGAGA
GAAGTTCGTAGCTGTGGTAGTAATTTGCATGTAACCGTTGGTGATCATTTATCTTCATGGGTGTCTCTTGTAGCCAGGGG
TATAACTGATTCATGGACTGAGGATGAGTCAGTCAGCCATCTGATGAGTCAAATGATTGACTTTTCCCCACATCCTCCTA
CATTTCAGAATGATGTGTCTGCTGCCAAAACCCTAAACTTGGATTATGGAGATTTATCTGCGAGTTTGTCTCGGGTTTTG
GGGCTGTGGAAGGGAAAAAAGGCAGGAAAAGTGGAAGACCTGATAGTGGAAAGATACATTTTCATGCTTTCTTCGGATAT
TGCTCGTATTAACTGTGCATTGGATAGTCAGCCCTCCTTGCATGTTAATTACCAGAATGTGGACATATCTAGCTCCGTGG
ATCTCATCTGCACCAGTCATTTGCTTGTAGGCGACATCAATGTTGTTGGTAGGAATATCGAGTTGAGAAACATTCTGATC
GGTGTTTTAAATCAGCTCCAGGCAGCACCTGAGCAGGTGGTTGAGGATTTGGGTTTTGATTTTATTCGCGAAGGAGCTTG
GCTCTCTCTTCTGTTGTACTTTCTTGATGGTGGCGTCTGGGATTATTGCAAGAAAAATTCATGTTCAGAAATCTATCCCT
TCTGGAGGGAGTGCACATCTGTTGACGCCAAGTATGTTGCTGCGGCAGAAGGGGTAGTCTCTTACTTGATGGAGACTGGT
GATATTGCAGAATTGCTGAGAATGCTTTCATCATTGGTTGGCAAATATTTGCGAGTGTATAAGAAAGCTTTCCTTGCAAC
TTTCAGCGCTTGGAATCATCACGGTCATAGTTCGCCTTCTCTGCTACTTCTCAAGCATACTCAATTTGGTAAAAGTCTTC
AAGGTGAATATGCGAAGATTGGTGACAATTCTCTCCATCTTCAATGTATATTTTATCTGTCAAAACTGGATGCTCTGGGA
GATGGAAGAGGTTCGGGTGTTTTATGGAAAGTGTTTTGGGAATTTATGGTACATGGGTTTCCCACTAGTCTTCAAACTTC
TAGTGCGATTCTTCTTTCATGTATTCTAAGCATAAGATGCATTGTGCTGACAATAGATGGCTTACTCAAACTGGGCAACT
CAAAGGAGAAGTTTGGGGCAGATACTAGTGTACTTCATCAGCTACTTGATTCTATCATGATTATTAAGTTTGATCAGGTA
TTCGAAAGCTTTCATGGAAAATGTGAGGAGATCCATCAAAACATATGTGCCGTGTTGCAGCTTCCAGATTTGACGGAGTT
GTTCCTGATGAAAGACATGGAGGGGTTTGTAAGAGATATCAGTGCTGAGCAGATAGATAGAAGTCATGTGCTTGAAGGGG
TGATCATCAAGATTGTAGATGTTATGGACAGTCTAAGCAAGGATTCTTCTAAATCTGATATTTTCAAATTTTATCTTGGT
GGAGATGCAGTCTCTGAGCATACCAGGGAATTTTATGAGTTGCAACGTGGAGATCTGTCTGTTTTTATTGACTCATTAGA
CTACTGTTCCTTGGAACCAGTAAACATAAAAGTACTTAACTTCCTTGTTGACCTTTTGTCTGTGGCTCAATCCCCCGATC
TCAGGAGAAGAGTACAACAAAAATTTATTGACATGGATTTGGTATCTTTGTCTGGGTGGCTGGAGAGAAGACTGTTGGGT
TCCTTCGTTGAGGAAATAGATGGGAAAAAGACTGCAAAAGGAAATTCTCTTCCTTTCAGAGAGGCAGCAATGAATTTTAT
TAATTGTCTTGTATCATCTACTAACGACCTACACCCCAGAGAGTTACAGAATCATTTATTTGAGGCCTTGCTGATCTCCC
TCGATAGCGCGTTTCTCTCATTTGATATCCATATGTCTATGTCATATTTTCATTTTGTTCTTCAACTTGCAAGGGAAGAC
AACCTGATGAAGATGGTTTTAAAGAGAAGCATAATGCTGATGGAGAAGCTTGCTGCCGATGAGAAGTTGCTTCCTGGTTT
GAAGTTTCTTTTTGGTGTGATAGGCACCTTGTTGAGCAACCGTTCTCCAAGTCATGGAGAGAGTTTGTGTGGAAAGTCCT
TGGCAAGCTATAAGAATACTGCAACAGGTCCTTTGGTCCCAAAACTTTCAGGAACAACGAAAAAATCTGATACATTGGCT
CTCCCCGTGGATCAGGAAGGAAGCTCAATATCACTTGAATGCGATGTCACCTCTGTTGATGAAGATGAAGATGATGGAAC
ATCTGATGGTGAAGTGGCCAGCTTAGACAAGGAAGATGAAGAAGATGCCAACAGTGAGAGTTATCTTGCCTCAAAAGTCT
GCACTTTTACGTCCAGTGGCAGTAATTTTATGGAACAACACTGGTATTTTTGTTACACCTGTGACCTTACTGTGTCCAAA
GGTTGCTGTTCTGTCTGCGCAAAAGTTTGCCACCGCGGTCACCGTGTTGTCTATTCACGATCGAGTCGGTTTTTCTGTGA
CTGCGGAGCTGGAGGTGTTAGGGGAAGCAGCTGCCAGTGCCTGAAGCCACGCAAATTTAATGGAAATGGAAGTGCTCCAG
CTCGTGGTACAAATAATTTCCAATCGTTTTTACCCTTGTCTGAGGATGCAGATCAGCTTGCAGAAAGCGATTCGGATGTG
GAAGAAGATGGTTTCGGGGAGGAAAATCACGTTGTGTTATCTATCCCTAAAGAAACTCAATATAAGATGTCACTGCTACT
CGAAGAGCTCGGGATAGAGGACCGAGTACTGGAGCTTTTCTCATCTTTGCTTCCGTCTATCACTAGCAAAAGAGACTCTG
GCCTTTCGAAAGATAAGCAGGTCAATCTCGGGAAAGACAAAGTTCTTTCATTTGACAAAGATCTTTTGCAGCTGAAAAAA
GCATATAAAAGTGGGTCACTGGACTTAAAAATAAAGGCTGATTATACTAATTCAAAGGACCTTAAATCTCTTTTAGCCAA
TGGTTCCCTTGTCAAGTCTCTCCTGAGTGTTAGTGTTCGGGGTCGCCTTGCAGTTGGAGAAGGTGATAAAGTTGCTATAT
TTGATGTTGGACAGCTAATAGGACAAGCCACAATTGCACCCATAAATGCAGACAAGGCCAACGTTAAACCACTTTCAAGG
AATATTGTTCGTTTTGAGATTGTGCATCTTGCATTCAACCCAGTTGTGGAGAATTATCTTGCTGTCGCAGGCCTTGAAGA
TTGCCAGATACTTACTTTGAATCATCGAGGTGAAGTCATCGACAGGCTTGCTGTTGAGCTTGCCCTGCAGGGTGCATTCA
TCAGGCGTATAGACTGGGTTCCTGGTTCACAGGTTCAGTTAATGGTTGTTACGAACAAATTCGTGAAGATTTATGATCTA
TCCCAGGATAGCATCAGTCCAACACAGTACTTCACCTTGCCAAACGACTTGATTGTGGATGCTACTCTTTTTGTTGCTTC
TCGTGGGAGGGTTTTCCTTCTTGTTCTTTCAGAACAAGGGAATTTGTATAGGTTCGAACTATCTTGGGGCGGAAACGCAG
GCGCAACACCACTTAAGGAAATCGTTCAGATTATGGGAAAGGATGTTACGGGAAAGGGTTCATCTGTCTATTTCTCTCCA
ACATATCGACTGCTTTTCATATCCTATCATGATGGAAGTTCTTTTATGGGTCGACTCAGCTCAGACGCAACATCCTTAAC
TGAGACATCTGGCATGTTTGAGGAAGAATCAGATTGTAAACAAAGGGTGGCTGGATTGCATCGTTGGAAAGAGTTGTTGG
CTGGTAGTGGATTGTTTATTTGCTTCTCCAGCGTGAAGTCAAATGCTGCTTTAGCTGTGTCCTTGAGGGGCGATGAAGTA
TGTGCACAGAATCTCCGTCATCCGACAGGATCATCTTCCCCTATGGTTGGAATAACCGCATACAAACCTTTGTCAAAAGA
CAATGTTCACTGTCTAGTTCTGCATGATGATGGCAGCCTTCAGATTTATTCTCATGTTCGGAGTGGAGTTGATGCTGACT
CAAATTTCACAGCTGAAAAAGTTAAAAAGTTGGGTTCTAAGATACTTAACAACAAAACCTATGCTGGTGCAAAGCCGGAG
TTTCCCCTGGATTTCTTTGAGAGGGCATTTTGCATTACAGCAGATGTGAGACTTGGCAGTGATGCTATTAGAAATGGTGA
TTCCGAGGGAGCAAAGCAGAGCTTGGCATCTGAGGATGGGTTTATTGAGAGCCCCAGTCCCATGGGCTTCAAGATATCTG
TCTCCAATCCAAATCCTGACATTGTTATGGTTGGCATCCGGATGCATGTGGGTACTACATCAGCAAGCTCTATACCTTCA
GAAGTGACCATTTTCCAGAGATCGATTAAGATGGATGAGGGCATGAGGTGCTGGTATGACATCCCATTTACTGTGGCTGA
GTCACTTCTAGCTGATGAAGATGTTGTAATATCTGTGGGGCCGACTACTAGTGGGACTGCACTGCCCAGAATAGACTCGC
TTGAAGTATACGGTCGAGCTAAAGATGAATTTGGCTGGAAAGAAAAAATGGATGCTGTGCTAGATATGGAAGCTCGTGTG
CTTGGTCATGGTTTGCTTCTTCCAGGCTCTAGTAAAAAGAGAGCGTTGGCACAGTCTGCTTCAATGGAAGAGCAAGTTAT
CGCCGATGGTCTTAAGCTCCTATCAATCTATTATTCAGTTTGTAGGCCACGGAAAGAAGTAGTGCTTAGCGAACTCAAAT
GCAAACAGCTACTGGAGACAATTTTCGAAAGTGATAGGGAAACGCTGTTACAAACTGCAGCTTGCCGTGTTTTGCAGTCT
GTCTTTCCAAGAAAGGAGATATACTACCAGGTCAAAGACACCATGCGTCTCCTTGGAGTGGTCAAGGTGACCTCTATTCT
TTCTTCGAGGTTGGGCATTTCTGGTACTGGAGGTTCGATTGTTGAAGAGTTCAATGCTCAGATGCGGGCGGTGTCTAAAA
TAGCTTTGACCCGTAAATCAAATTTCTCCGTCTTTCTGGAGATGAATGGCTCTGAAGTGGTTGATAATCTGATGCAAGTG
CTATGGGGAATTTTGGAGTCAGAGCCACTCGATACACCTACTATGAACAATGTTGTGATGTCCTCCGTTGAACTAATCTA
TAGCTATGCAGAGTGTTTGGCATCTCAAGGAAAGGATACAGGGGTTCATTCTGTAGCTCCTGCAGTTCAGTTACTGAAAA
CACTTATATTGTTTCCCAATGAGTCTGTGCAAACATCCAGCAGGTGTGTTCTTGTCTTAGCTATATCATCAAGGTTACTT
CAGGTTCCTTTCCCAAAGCAAACAATGTTGACAACAGATGATTTGGTTGACAATGTTACAACTCCTTCGGTGCCTACCAG
AACAGCTGGTGGAAATACACATGTCATGATTGAGGAGGACTCTATAACTTCATCTGTTCAATACTGCTGTGATGGCTGCT
CCACCGTCCCTATACTGAGAAGAAGGTGGCACTGCACTGTTTGTCCAGATTTTGATCTATGTGAGGCATGCTATGAAGTG
TTAGATGCAGATCGTCTACCACCACCACACACTCGAGACCATCCCATGACAGCAATTCCAATAGAAGTGGAATCACTTGG
TGCAGACACCAATGAGATTCAGTTCTCTGCGGATGAAGTAGGTATTTCAAATATGTTGCCGGTGATAACCAGTAGCATCC
CACAAGCTTCAACTCCCTCCATTCATGTCTTGGAACCTGGTGAATCTGCTGAGTTCTCTGCCTCAGTGACCGATCCTATA
TCTATCTCAGCGTCAAAGCGTGCCGTAAATTCTTTAATTCTGTCTGAGTTTCTCCAAGAGTTGAGTGGATGGATGGAGAC
AGTATCCGGTGTTCAAGCTATTCCTGTGATGCAATTGTTCTACAGATTATCATCTGCCATTGGTGGAGCCTTTATGGATA
GCTCAAAGCCCGAAGAAATAAGCTTGGATAAATTAATTAAATGGCTTTTGGGTGAAATCAATCTCAGCAAGCCGTTTGCT
GCTTCAACTCGCTCTTCCTTTGGGGAAATTGTGATTCTTGTGTTTATGTTTTTCACCTTGATGCTTCGGAGTTGGCACCA
GCCTGGTAGTGATGGTAGTAGCTCCAAATTAGGTGGAAGTACAGATATACATGACCGGAGGAGTGTCCAGAGCTCCACTG
TAGTAGCTACTCAGTCTTCTTTAGATGTTCAAGAGAGAGATGACTTTGCGTCTCAGCTAGTTCGTGCGTGCAGTTGCCTC
AGGAACCAAGAGTTTGTTAATTATCTAATGAACATACTTCAGCAGCTAGTGCATGTTTTTAAGTCACGTGCTGCCAATGT
TGAAGCTCGTGGATCAAGCGCTGGTTCTGGTTGTGGAGCCATGCTCACAGTCAGAAGAGATTTACCTGCGGGTAACTATT
CTCCCTTCTTTTCGGATTCATATGCAAAAGCCCATAGAGCAGATATATTTGTGGACTATCACAGGCTGCTACTTGAGAAT
GTGTTTCGCTTAGTATATACCTTGGTTAGACCTGAAAAACAAGAGAAAATGGGGGAAAAGGAAAAGGTATACAGGAATGC
TTCTTCTAAAGATTTAAAGCTGGACGGTTTCCAGGATGTTCTATGCAGCTATATTAATAACCCTCATACGGGTTTTGTTA
GGAGATATGCTAGAAGGCTGTTTTTGCATCTTTGCGGAAGCAAAACTCAATACTACAGTGTCCGAGATTCATGGCAGTTT
TCCAATGAAGTGAAAAACCTATACAAGCATGTTGAAAAGTCTGGTGGTATTGAAAACAATGTTTCATATGAAAGAAGTGT
AAAGATTGTGAAGTCGCTTTCTACAATTGCTGAAGTTGCTTTGGCGCGACCTCGGAACTGGCAGAAGTACTGTCTTAGGC
ATGGAGATTTTCTGTCCTTCCTACTAAATGGTGTATTCCATTTTGCGGAAGAGTCTGTTATCCAGACACTTAAACTCCTC
AATTTGGCCTTTTATCAAGGAAAAGATGTGAGCAGCTCAGTGCAGAAAGCTGAAGCAACTGAAGTAGTGACAGGCTCAAA
CCGATCAGGATCTCAGTCAGTGGATTCAAAAAAGAAGAAAAAAGGTGAAGATGGGCATGATTCTGGTTTGGAAAAATCAT
ATGTGGATATGGAAGGGGTGGTCGATATCTTCAGTGCCAAGGGCGGAGATCTCTTGAGGCAGTTTATTGATTTCTTTCTA
CTGGAATGGAATTCAAGCTCTGTTCGCACTGAAGCAAAATCTGTTATTTATGGCCTGTGGCATCATGGAAGACACTCATT
CAAAGAAAGTCTGTTAGCAGCTCTGTTGCAGAAGGTTAGATACCTGCCTGCATATGGTCAGAATATTGTTGAGTACACAG
AACTTGTCTCCTTGTTGCTCGGCAAGGCTCCAGAAAACAACTCAAAGCAAGCAATTAATGAGCTTGTGGATCGTTGCCTG
AACCCTGATGTGATAAGGTGCTTTTTTGAGACGCTGCATTCCCAGAACGAACTCATTGCCAATCATCCAAACTCCCGTAT
ATACAGCACTCTGAGTAATCTTGTGGAATTTGATGGTTATTATCTTGAGAGCGAACCTTGTGTTGCCTGCAGTTCTCCTG
ATGTGCCATATAGCAAAATGAAGCTTGAAAGTTTGAAATCCGAGACAAAGTTTACCGATAACCGCATCATTGTGAAATGT
ACTGGGAGTTATACGATACAGTCTGTGACAATGAATGTTCATGATGCACGAAAGTCAAAGTCGGTGAAGGTCCTGAACTT
GTATTACAACAATCGCCCTGTCTCGGATTTATCAGAGCTTAAAAATAACTGGTCAATGTGGAAGCGTGCCAAAAGTTGCC
ATCTGTCTTTTAACCAAACTGAACTGAAGGTGGAATTTCCTATTCCTATTACTGCGTGTAACTTCATGATCGAGTTGGAT
TCCTTCTATGAGAATCTTCAAGCGTTATCTCTTGAACCATTGCAGTGTCCTCGATGCAGCCGACCTGTTACTGATAAACA
TGGTATTTGCAGCAACTGCCATGAGAATGCTTATCAGTGCAGGCAGTGCCGTAACATTAATTATGAAAATTTGGATTCAT
TCCTTTGCAACGAGTGTGGCTACAGCAAGTATGGGAGGTTTGAGTTTAACTTCATGGCAAAACCAAGCTTCATATTTGAT
AATATGGAAAATGACGAAGATATGAAGAGGGGATTGGCTGCTATAGAATCTGAGTCTGAAAACGCTCACAAGAGATATCA
GCAACTCCTGGGCTTCAAGAAGCCTCTTCTGAAGATAGTTTCAAGCATTGGTGAAACTGAAATGGATTCGCAGCACAAGG
ACACTGTCCAGCAAATGATGGCATCTTTACCTGGTCCATCATGCAAGATAAACCGCAAAATCGCACTTTTGGGTGTACTG
TATGGTGAGAAGTGCAAAGCTGCTTTTGATTCTGTCAGCAAAAGTGTACAAACGCTGCAGGGGCTTCGCAGAGTTTTGAT
GAGCTACCTCCATCAGAAAAATTCCAATTTTTCATCAGGTGCCTCAAGATGTGTGGTCTCAAAGACCTTAAACAATTGTT
ACGGTTGTGCCACTACATTTGTCACTCAATGTCTTGAGATTCTTCAAGTGCTGTCGAAGCATCCAAGATCTAGAAAACAA
CTTGTTGCAGCTGGTATTTTGTCTGAGTTGTTTGAAAACAATATTCACCAAGGTCCGAAAACAGCCCGTGCTCAAGCTAG
AGCAGCCCTTTCTACTTTCTCGGAGGGTGATCTGAATGCAGTGAATGAGTTAAACAATCTGGTACAGAAGAAAATAATGT
ACTGCCTTGAACACCATCGTTCCATGGATATTGCGCTCGCCACTCGTGAGGAAATGTTGTTGCTTTCAGAAGTTTGCTCT
CTCACTGATGAATTCTGGGAGTCAAGACTGCGCCTTGTTTTTCAGCTACTATTTTCATCCATTAAATTGGGTGCTAAACA
TCCTGCGATATCAGAGCAAATAATTCTTCCTTGCCTTAAGATTATTTCTGTGGCATGTACACCTCCAAAACCAGATACGG
CAGAGAAAGAGCTTACGATGGGAAAATCTACTCCTGCAGTGCAAGAAAAGGATGAGAGTGCTGCTGGCATCATAAAGTAT
TCATCAGAAAGCGAAGAAAATAACCCGAATGTATCTCAGAAGACGCGAGATATTCAGCTTGTGAGTTATTTGGAATGGGA
GAAAGGGGCATCATATCTCGACTTTGTGAGGAGGCAATACAAAGCCTCTCAGTCAATTAGAGGTGCTAGCCAAAAGTCTA
GAACCCACAGATCAGATTTCTTGGCACTTAAATATACACTTAGGTGGAAGCGACGGTCTAGCAGGACATCTAAAGGTGGT
TTACAGGCATTTGAGCTCGGGTCTTGGGTCACAGAGCTTATTCTTAGTGCATGTTCTCAATCTATCAGGTCAGAGATGTG
CACGCTGATTAGTTTACTCGCTGCACAAAGCTCACCTAGGCGCTACAGGCTGATCAATTTGCTGATAGGCTTGCTTCCCG
CTACGCTTGCAGCGGGTGAAAGCAGCGCAGAATACTTTGAACTGCTCTTCAAAATGATAGAGACACAAGATGCACTTCTT
TTCTTAACTGTCCGGGGTTGTCTGACAACAATCTGTAAATTGATCTCCCAAGAGGTGGGAAACATTGAATCTCTAGAAAG
GAGTCTTCAGATCGACATTTCACAGGGATTTACCCTCCACAAGCTCTTAGAACTCCTTGGAAAGTTCTTAAAGGTTCCAA
ATATTCGTTCCAGATTCATGAGAGACAATTTACTGTCTCATGTTCTGGAGGCCCTCATTGTAATTCGTGGCTTGATAGTG
CAAAAGACAAAGCTTATAAATGATTGCAACAGACTCCTAAAAGATCTTCTTGACGGACTTCTGCTTGAAAGCAGTGAAAA
TAAACGACAATTTATCCGTGCCTGTGTTTCTGGACTGCAAACCCATGCAGAGGAGAAAAAAGGACGTACCTGTATGTTTA
TTCTTGAGCAACTTTGTAATTTGATCTGCCCGTCAAAACCTGAGGCTGTGTATATGCTGATCTTGAACAAATCACACACG
CAAGAGGAGTTCATCCGGGGATCAATGACAAAAAATCCATATTCGAGTGCTGAGATTGGCCCACTGATGCGGGATGTTAA
AAACAAGATTTGTCAGCAGTTGGACCTGTTAGGACTACTGGAAGATGACTATGGCATGGAGTTGCTTGTAGCAGGAAACA
TCATTTCACTAGACCTGAGCATAGCTCAAGTTTATGAGCTAGTTTGGAAGAAATCAAATCAGTCTTCTACTTCACTGACC
AACTCCGCACTGTTAGCTTCAAATGCAGCTCCCGGCAGGGATTGTCCTCCCATGACGGTGACATACAGACTTCAGGGGTT
AGATGGTGAAGCTACTGAGCCTATGATCAAGGAATTGGAAGAAGATAGAGAAGAATCACAAGATCCAGAGATTGAGTTTG
CAATAGCAGGTGCAGTTCGGGAATATGGTGGTCTTGAAATTTTACTTGATATGATCAAGAGTTTACAAGATGACTTCAAA
TCCAACCAAGAAGAGATGGTTGCAGTTCTTGATCTCCTAAACCATTGCTGCAAGATTAGAGAGAACAGGCGAGCTCTACT
CAGGCTAGGGGCTTTAAGCTTACTTCTTGAAACAGCTAGGAGGGCATTTTCTGTGGATGCTATGGAGCCAGCTGAAGGCA
TTCTCTTAATTGTCGAGAGTTTGACTCTTGAAGCAAATGAAAGTGACAGCATCAGCGCCGCACAAAGTGCTTTGACTGTC
AGTAACGAGGAAACTGGAACTTGGGAACAGGCCAAGAAAATAGTGCTTATGTTCTTAGAAAGGCTAAGCCATCCTTCAGG
GCTTAAGAAGTCAAACAAACAGCAAAGGAACACGGAGATGGTTGCTAGAATCTTACCTTACTTAACATACGGTGAGCCTG
CAGCGATGGAAGCACTCATAGAGCATTTTAGCCCTTACCTGCAAAACTGGTCTGAATTTGATCAGCTTCAGCAACGTCAT
GAGGAGAACCCCAAGGACGACAGCATTGCTCAGCAAGCGGCGAAGCAGAGGTTTACTGTGGAGAATTTTGTAAGAGTGTC
AGAATCTCTCAAGACAAGTTCATGTGGAGAGAGGTTAAAAGACATAGTTTTGGAGAATGGTATCATAGCTGTTGCTGTCA
AACACATAAAGGAAATTTTCGCTGTCACGGGACAGACTGGGTTCAAATCTAGCAAGGAATGGCTTTTGGCTCTTAAACTT
CCGTCAGTGCCTCTTATTTTGTCAATGCTAAGAGGATTGTCGATGGGTCATTTGCCTACCCAAACATGCGTAGACGAGGG
AGGAATTTTAACCCTACTTCATGCCTTAGAAGGAGTCTCTGGAGAAAACGACATCGGTGCAAGGGCTGAAAATTTGCTAG
ACACACTCGCCGATAAAGAAGGAAAAGGAGATGGATTTCTTGGAGAGAAAGTCCGTGCATTACGAGATGCCACCAAAGAT
GAAATGAGACGCCGTGCATTAAGAAAGAGAGAGGAGCTCCTGCAGGGACTTGGAATGCGTCAAGAGCTATCTTCTGATGG
TGGTGAAAGGATTGTGGTTTCTCAACCAATTCTTGAAGGTTTTGAGGATGTAGAGGAAGAAGAAGATGGATTGGCTTGCA
TGGTGTGTAGAGAAGGCTACAAGCTCAGACCTTCTGATTTATTAGGAGTCTACTCTTACAGTAAACGGGTGAATCTGGGT
GTTGGCAATTCTGGATGCGCACGTGGCGAATGCGTTTACACTACCGTGAGCTACTTCAACATCATTCATTTCCAATGTCA
TCAAGAGGCGAAAAGAGCCGACGCTGCTCTTAAAAATCCGAAGAAAGAATGGGAAGGAGCTATGTTACGTAACAATGAAT
CTCTTTGCAACTCTCTCTTCCCTGTCAAGGGTCCCTCAGTTCCCTTAGCACAGTATCTTCGTTACGTTGACCAGTACTGG
GATAATCTCAATGCTCTTGGTCGAGCCGACGGAAGCAGACTCCGTCTATTGACATACGACATTGTCCTGATGCTGGCTCG
GTTTGCAACAGGAGCTTCTTTTAGCGCGGATTGTCGAGGTGGAGGAAGAGATAGCAATTCCCGCTTCTTGCCTTTCATGT
TCCAAATGGCCCGTCATCTTCTCGACCAAGGAGGCCCCGTGCAACGCGCAAACATGGCTAGATCTGTTTCATCGTACATT
TCGTCATCATCGACATCTACAGCAACAGCTCCATCCTCGGACTCACGACCTTTAACTCCTGGATCTCAGCTATCATCAAC
TGGAACAGAGGAAACGGTTCAGTTCATGATGGTTAACTCACTTCTATCAGAATCATATGAATCATGGCTCCAACACCGTA
GGGTCTTTCTCCAGCGGGGGATTTACCATACTTTCATGCAACACGCTCACGGTCGGGTAGCTACTCGCGCTGCAGAACCA
ACCAGTTCGGGAGGCAAAACCCAAGACGCAGAAACCTTAACCGGCGATGAACTTCTCTCTATCGTCAAACCAATGCTGGT
TTACACCGGTATGATCGAACAGCTTCAACAGTTGTTCAAACCCAAGAAACCGGTCCACATCGAACCAATCAAGAAAGAAG
GTACATCAAGTGGAGTAGAGCTTGAGCCATGGGAGATTGTAATGAAAGAGAAGCTGCTGAATGTGAAAGAAATGGTTGGT
TTCTCCAAGGAATTGATCTCGTGGCTCGACGAAATCAACTCTGCAACTGATCTACAAGAAGCATTTGATATTGTAGGCGT
TTTGGCTGATGTTTTGTCTGAAGGATTTACACAGTGTGATCAGTTTGTGAGATCGGCGATCGATAAAGATTGA