Details for Lyrate rockcress Locus 16052523

Position : sca3 ( 5`- 1108951 .. 1105590 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052523

Protein [Map View]
MDDNRSSESIKRHEIEKDTIASRKLEDSNAKLIQDPEEMALYAKVRSQEEEIHSLQERIAAACLKDMQLLNEKYGLERKC
ADLRVAIDEKQNESVTSALNELARRKGDLEENSKLAHDLKVTEDERYIFMTSLLGLLAEYGVWPRVANATAISSGIKHLH
DQLQWKTKACNDRIRELSSIVENQPGTDFISKDNHDPRNSKSQASYGSTDRGNDYQTNEQLLPPMENVTRNPYHNVMQDT
EGLRFNNQIGGGSQGIFQQPKRENFGYPLSSVAGKEMIREREEKAESSSMFDAYNGNEEFASHVYEEGPGIDGFQIIGDA
IPGEKVLGCGFPVRGTTLCMFQWVRHLEDGTRQYIEGATHPEYVVTADDVDKLIAVECIPMDDQGRQGELVRLFANDQNK
IRCDTEMQAEIDTYISRGQASFNVQLLMDSSESWETATVILKRSSYQIKTNTTEVISEKYSKELQIKVPCGFSTQFVLIS
YDGSSHPISTLNVRMRDTLVLTMRMLQSKALDERRKGRV*

DNA
ATGGATGACAATCGGAGTTCTGAATCAATCAAAAGGCATGAGATTGAGAAAGATACTATTGCTTCGAGGAAGCTAGAAGA
TAGTAATGCTAAGTTAATTCAAGATCCTGAGGAAATGGCACTTTATGCAAAAGTGAGATCACAAGAAGAGGAAATTCATA
GTCTCCAGGAACGAATTGCTGCTGCTTGTTTGAAGGATATGCAGCTTCTCAATGAGAAGTATGGATTAGAGAGAAAATGT
GCTGATCTTCGAGTGGCAATTGATGAGAAACAAAATGAATCTGTTACATCTGCGTTGAATGAGTTGGCTCGTAGAAAAGG
TGATCTGGAAGAAAATTCGAAGTTGGCACATGATTTAAAGGTTACAGAAGACGAGAGGTATATATTCATGACGTCCTTAC
TTGGTTTATTAGCTGAGTATGGTGTTTGGCCTCGTGTTGCAAATGCTACCGCTATATCCAGCGGCATAAAGCACTTGCAT
GATCAGTTGCAATGGAAGACTAAAGCTTGCAATGATAGGATTAGAGAATTATCATCTATTGTGGAAAACCAACCGGGAAC
AGACTTTATTAGTAAAGACAACCATGATCCTAGAAATTCGAAAAGTCAAGCTTCTTATGGATCCACGGATCGTGGTAATG
ATTATCAGACCAATGAACAACTTTTGCCACCAATGGAAAATGTTACGAGAAACCCGTATCATAACGTTATGCAAGACACT
GAAGGTTTAAGATTTAATAATCAGATAGGCGGTGGATCTCAAGGAATTTTCCAGCAGCCGAAAAGGGAAAATTTTGGATA
TCCTCTAAGTAGTGTGGCGGGGAAGGAAATGATTCGAGAAAGAGAAGAAAAAGCTGAGAGTTCTTCCATGTTTGATGCTT
ATAACGGGAATGAAGAGTTTGCTTCTCATGTTTATGAAGAGGGACCAGGAATTGATGGATTTCAGATTATTGGTGATGCA
ATACCTGGAGAAAAAGTTCTTGGTTGTGGTTTTCCAGTGCGAGGAACCACTCTCTGTATGTTTCAGTGGGTTCGGCATCT
TGAAGATGGCACAAGACAATACATCGAGGGAGCCACCCACCCAGAGTATGTTGTAACTGCGGATGATGTAGATAAACTGA
TTGCTGTTGAGTGTATTCCAATGGATGATCAAGGTCGTCAGGGAGAATTAGTGAGATTGTTTGCTAATGATCAAAACAAG
ATTAGATGTGATACAGAGATGCAAGCAGAAATCGACACTTATATATCCAGAGGTCAAGCAAGCTTTAATGTGCAGCTTCT
GATGGATTCATCAGAGAGTTGGGAAACCGCAACGGTTATTTTGAAGAGATCTAGTTACCAGATTAAAACGAACACCACAG
AAGTGATCTCAGAGAAATACTCAAAGGAACTCCAGATAAAAGTACCGTGTGGATTCTCAACACAGTTTGTTCTGATAAGT
TATGATGGATCTTCACATCCTATAAGCACACTCAATGTCCGTATGCGTGATACGCTAGTCTTGACGATGAGAATGCTTCA
AAGCAAGGCACTGGACGAACGCAGAAAAGGACGAGTTTAA