Details for Lyrate rockcress Locus 16052476

Position : sca2 ( 5`- 16463277 .. 16465417 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052476

Protein [Map View]
MADQETLAALKRAYADTILNTTKEAAARVMVSEKKARRYQQELVTVRDEALQTLLRLKQMLDSKVKETEMQSLKQQQKVE
ELEAQLGEAEDIVGELRMELRVLHNELKKLTNGQTHLKSDHEEDPCGNNRDAAVSVVPEVSCSHESTEAVDFCIPVEQSG
SVVANGIKVPSLTRINSINRCSYKDNKDQCHHTLPSILTKRREAEGLAQMIHAVDSSMANGVLSSSVEVGDVNDGVCLHK
VSSCKIVETLEMSGCADATDSISTVRDGEAPKVSPNSSQKEVGTLVSLITSPPREHENDGKLEISETEARKEEKESCENI
EVSASPLCEETPVLALSKNRCIKYTFKRKRKKEVLSNNLEGDASFEESRNMKQKTGEKDDGYLESLKPSFTSESSRDVVY
A*

DNA
ATGGCTGACCAAGAGACCTTAGCGGCGTTGAAGAGAGCCTACGCCGATACGATACTGAACACAACGAAGGAAGCGGCGGC
GCGTGTGATGGTTTCTGAAAAGAAGGCGCGTAGGTATCAGCAAGAACTTGTGACGGTTAGAGATGAAGCACTTCAGACGT
TGCTTAGGCTTAAACAGATGCTTGATTCCAAGGTCAAAGAGACGGAGATGCAGTCCTTGAAGCAGCAACAGAAGGTTGAG
GAACTTGAAGCTCAGCTTGGAGAAGCTGAAGATATTGTAGGCGAGCTGAGGATGGAGTTGAGAGTACTCCACAATGAGCT
CAAGAAACTTACGAATGGTCAGACACATCTTAAAAGTGATCATGAGGAAGACCCCTGTGGGAATAACCGCGATGCTGCAG
TTTCTGTAGTGCCTGAGGTTTCTTGCAGTCACGAGAGCACAGAAGCTGTAGATTTTTGCATCCCAGTGGAACAAAGTGGA
TCAGTGGTGGCTAATGGGATAAAAGTACCATCTTTGACTCGCATAAATAGTATTAACCGGTGTTCTTATAAAGATAACAA
GGATCAGTGTCACCACACTCTTCCATCTATACTGACAAAACGCAGGGAAGCTGAAGGTTTAGCTCAGATGATCCACGCAG
TAGATAGCAGTATGGCCAATGGGGTTCTGTCGTCCTCTGTAGAAGTAGGAGATGTGAATGATGGAGTATGTCTTCACAAA
GTTTCGTCTTGTAAAATTGTAGAGACCTTAGAAATGTCTGGTTGTGCTGATGCTACTGACTCCATATCTACTGTTAGAGA
TGGAGAAGCCCCGAAAGTGTCTCCAAACTCTTCTCAGAAGGAAGTCGGCACTCTTGTATCCTTGATAACATCTCCTCCGA
GGGAACATGAAAATGACGGAAAGCTGGAGATTAGCGAAACAGAGGCGAGGAAGGAAGAAAAAGAGAGCTGTGAGAATATT
GAGGTTTCGGCATCTCCTTTGTGCGAAGAAACTCCAGTTTTAGCACTTAGTAAAAATCGGTGTATCAAGTACACGTTCAA
GAGGAAGAGAAAGAAGGAGGTGTTAAGCAACAATCTTGAAGGAGATGCATCGTTTGAGGAGAGCAGAAACATGAAACAGA
AGACCGGAGAGAAAGACGATGGTTACTTGGAGTCTCTGAAGCCTAGTTTTACCAGTGAATCATCTCGGGATGTAGTCTAT
GCTTAG