Details for Lyrate rockcress Locus 16052474

Position : sca3 ( 5`- 6582059 .. 6581709 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052474

Protein [Map View]
MATIISCSALSSIRASSESDPSRKKPVSSVSWWAPLFGMSSEPDYVNKTVNLESDLDKTDKRSLRCCLTEEKAKQLRRKT
AEASTFHDVMYHSAIASRLASDVRVKE*

DNA
ATGGCTACAATCATCTCATGCTCCGCTCTTTCCTCGATCCGAGCATCTTCCGAATCGGATCCATCCCGTAAGAAACCCGT
TTCATCGGTTTCATGGTGGGCTCCTCTTTTTGGCATGTCATCGGAACCTGATTACGTCAACAAGACCGTGAATCTGGAAT
CAGATCTGGATAAAACTGACAAGAGGTCTCTGCGGTGTTGTCTCACGGAGGAGAAAGCTAAGCAGCTGCGGAGGAAAACC
GCCGAAGCTTCCACGTTTCACGACGTTATGTACCATTCTGCGATCGCTTCGCGACTCGCGTCTGACGTTAGGGTCAAGGA
GTAA