Details for Lyrate rockcress Locus 16052457

Position : sca3 ( 5`- 5009468 .. 5005531 -3` )
Annotation : [B2G] SULTR4_2 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052457

Protein [Map View]
MSLAVKDLSTASSSSSTAIPVKIIPLQHPDSTSSDPHCHSIPFNDFFSRWTVKIKRMTFFDWIDTIFPCFLWIRTYRWHQ
YFKLDLMAGITVGIMLVPQAMSYARLAGLQPIYGLYSSFVPVFVYAVFGSSRQLAVGPVALVSLLVSNALGGIVDPSEEL
YTELAILLALLVGIFECIMGFLRLGWLIRFISHSVISGFTTASAVVIGLSQLKYFLGYSVSRSSKIMPVIESIIAGADQF
KWPPFLLGSTILVILLVMKHVGKAKKELQFVRAAGPLTGLALGTMIAKVFHPPSITLVGDIPQGLPKFSFPKSFDHAKLL
LPTSALITGVAILESVGIAKALAAKNRYELDSNSELFGLGVANIFGSLFSAYPTTGSFSRSAVNSESEAKTGLSGLVTGI
IIGCSLLFVTPMFKFIPQCALAAIVISAVSGLVDYEGAIFLWRVDKRDFTLWTITSTTTLFFGIEIGVLIGVGFSLAFVI
HESANPHIAVLGRLPGTTVYRNMKQYPEAYTYSGIVIVRIDAPIYFANISYIKDRLREYEVAIDKHSSKGPDMERIYFVI
LEMSPVTYIDSSAVEALKDLYEEYKTRGIQLAISNPNKEVLLTLARAGIVELIGKEWFFVRVHDAVQVCVHYVNTPTNVE
ESSKSSLWRRNGAKNSPSHAEVEPDIVLKEPLLSREK*

DNA
ATGTCTCTCGCCGTCAAGGATCTCTCCACCGCTTCGTCCTCTTCATCCACGGCGATTCCGGTGAAGATCATTCCTCTCCA
GCATCCCGATTCCACCTCTTCTGATCCTCACTGTCACTCCATTCCCTTCAATGATTTCTTCTCCCGATGGACGGTGAAGA
TCAAGCGTATGACGTTCTTCGACTGGATTGATACCATATTTCCTTGCTTCCTTTGGATTCGGACTTACCGGTGGCATCAA
TACTTTAAGCTCGATCTTATGGCTGGTATCACCGTCGGTATCATGCTTGTTCCCCAGGCAATGTCGTATGCAAGGTTAGC
TGGGCTTCAACCAATATACGGTCTATACTCCTCATTTGTGCCTGTATTTGTGTATGCCGTTTTCGGTTCATCCCGTCAGC
TTGCAGTTGGACCTGTAGCATTAGTTTCCCTTCTCGTCTCTAATGCCTTGGGTGGAATTGTTGATCCATCTGAAGAGTTA
TACACTGAGCTTGCCATTTTGCTGGCTCTTCTGGTTGGGATATTTGAGTGCATTATGGGGTTCTTGAGGCTTGGATGGCT
TATTCGTTTCATAAGTCACTCAGTCATTTCTGGATTTACAACTGCTTCAGCTGTTGTGATTGGGTTATCCCAATTGAAAT
ACTTTCTAGGGTATAGCGTTTCTCGGAGCAGCAAGATTATGCCAGTAATTGAGAGCATAATAGCTGGAGCTGATCAGTTT
AAGTGGCCACCTTTCTTGTTGGGATCTACCATTCTGGTGATCCTTTTAGTAATGAAGCATGTGGGAAAAGCAAAGAAGGA
ACTTCAGTTCGTACGAGCAGCAGGACCGCTCACAGGGCTTGCTCTTGGTACAATGATTGCAAAAGTGTTCCATCCACCTT
CCATCACACTGGTGGGAGATATACCTCAGGGACTTCCAAAGTTTTCTTTCCCAAAAAGTTTTGATCATGCTAAATTACTG
CTTCCAACATCGGCTCTCATTACTGGTGTTGCCATCTTGGAATCTGTAGGTATTGCGAAAGCACTAGCCGCGAAAAATAG
ATACGAACTGGATTCAAATTCAGAGTTGTTTGGTCTTGGTGTTGCAAATATATTTGGGTCACTATTCTCTGCATATCCAA
CTACAGGATCCTTTTCTAGGTCAGCGGTGAATAGTGAAAGTGAAGCCAAGACTGGCCTATCAGGCCTTGTAACAGGAATT
ATCATTGGATGTTCTCTACTGTTCGTGACCCCAATGTTTAAATTTATACCACAGTGTGCTTTAGCAGCAATAGTGATCTC
TGCTGTTAGTGGCTTGGTGGACTATGAAGGGGCAATCTTTCTGTGGCGTGTGGACAAGAGAGATTTTACTCTTTGGACCA
TCACTAGCACTACCACTTTGTTCTTTGGAATAGAGATTGGGGTCCTCATTGGTGTTGGTTTTTCACTTGCATTTGTAATA
CACGAGTCTGCAAATCCTCATATAGCTGTCTTGGGGCGTCTTCCAGGAACCACTGTGTACAGAAACATGAAGCAGTATCC
AGAGGCATACACTTACAGTGGAATTGTGATTGTTCGAATCGATGCTCCCATTTATTTTGCCAACATAAGCTACATCAAGG
ACAGGCTACGAGAATATGAAGTAGCTATCGACAAACACTCAAGCAAGGGACCAGATATGGAGAGGATCTACTTTGTTATC
CTGGAAATGTCTCCTGTCACATACATTGACTCAAGCGCAGTAGAAGCCTTAAAAGATTTGTACGAGGAGTATAAAACAAG
GGGGATTCAGCTAGCGATCTCGAACCCAAACAAAGAGGTTCTCTTAACTCTAGCAAGAGCAGGCATTGTGGAACTTATTG
GCAAAGAATGGTTCTTCGTGAGAGTACATGATGCAGTCCAAGTTTGTGTTCATTACGTCAATACACCCACAAATGTTGAA
GAAAGTAGCAAATCAAGCTTATGGAGAAGAAATGGCGCAAAAAACTCACCATCACACGCTGAAGTTGAACCCGACATAGT
TTTAAAAGAACCATTGTTGTCCAGGGAGAAATAA