Details for Lyrate rockcress Locus 16052447

Position : sca3 ( 5`- 6687905 .. 6685332 -3` )
Annotation : [B2G] glycosyl transferase family 1 protein
External links : CoGe
PGDD synteny : 16052447

Protein [Map View]
MEDLRLSPLKLGSFKSSLSGKSTPRGSPTSRRVHSGRTPRRDGKGSGGAVQWFRSNRLLYWLLLITLWTYLGFYVQSRWA
HDDDNKVEFLRFGGKLREDVLHVEQNKRLDSVANENSHAVVDTTNIVHIGVNKRMHVTLAKKEDDTSQRSLSSRRRTRKA
SRSSRTRIRSKQKVRKVMETKDLDEQDQELPNTNVTYGKIFGPFGSLEDRVLEWSPQKRSGTCDRKSDFKRLVWSRRFVL
LFHELSMTGAPISMMELASELLSCGATVYAVVLSRRGGLLQELTRRRIKVVEDKGELSFKTAMKADLVIAGSAVCASWID
QYMDHHPAGGSQIAWWVMENRREYFDRAKPVLDRVKLLIFLSEVQSKQWLTWCEEDHIKLRSQPVIVPLSVNDELAFVAG
IYSSLNTPTLTQEMMKEKRQKLRESVRTEFGLTDKDMLVMSLSSINPGKGQLLLLESVALALEREQEQEQVAKSNQQPKI
KNLNGIRKEKISLSVKHRLRGSLRKMKITTPATDNSSVLSATGKRKLLFSGNVTQKQDLKLLLGSVGSKSNKVAYVKEML
SFLSNNGNLSNSVLWTPATTRVASLYSAADVYVTNSQGIGETFGRVTIEAMAYGLPVLGTDAGGTKEIVEHNVTGLLHPV
GRAGNKVLAQNLLFLLRNPSTRLQLGSQGREIVEKMYMKQHMYKRFVDVLVKCMRP*

DNA
ATGGAAGATCTTCGGCTATCACCGCTGAAACTAGGTAGCTTTAAGTCTTCATTGTCAGGGAAGTCTACTCCAAGGGGTTC
ACCTACATCTAGGAGAGTGCATTCAGGCAGGACTCCACGTAGAGATGGCAAAGGTAGTGGTGGAGCTGTTCAGTGGTTCA
GAAGTAACCGGCTGCTATATTGGTTACTGTTGATTACTCTTTGGACATATCTTGGATTTTATGTTCAGTCCAGATGGGCA
CATGATGATGATAACAAAGTTGAGTTCTTACGGTTTGGAGGCAAACTGAGAGAAGATGTTTTGCATGTGGAGCAGAATAA
ACGACTTGATTCAGTTGCTAATGAGAATTCTCATGCTGTAGTAGATACTACCAATATAGTCCATATAGGTGTAAATAAGA
GGATGCATGTAACTTTGGCCAAGAAAGAGGATGACACATCTCAAAGAAGCTTGAGCTCCAGGAGGAGGACCAGAAAAGCT
AGTCGTAGTTCACGTACTAGGATTCGTAGTAAGCAGAAGGTGAGAAAAGTGATGGAGACTAAGGACTTGGATGAGCAAGA
TCAAGAACTTCCAAACACAAATGTTACCTACGGTAAGATTTTTGGTCCTTTTGGATCACTGGAGGATAGAGTTCTTGAAT
GGAGTCCGCAAAAGCGATCAGGGACCTGTGACAGGAAATCAGACTTCAAACGTCTTGTTTGGTCTAGGAGATTCGTCCTA
CTTTTCCATGAACTATCAATGACTGGTGCTCCAATTTCAATGATGGAGTTGGCTTCCGAGCTTTTGAGCTGTGGTGCAAC
AGTATATGCAGTAGTCCTGAGCAGAAGGGGTGGATTATTGCAAGAGCTCACAAGGAGAAGGATCAAAGTGGTTGAAGACA
AAGGAGAACTCAGCTTCAAAACTGCCATGAAAGCAGATCTTGTCATTGCAGGATCAGCAGTGTGTGCTTCATGGATAGAT
CAATACATGGATCACCATCCAGCTGGTGGAAGTCAAATCGCTTGGTGGGTGATGGAGAACCGGCGAGAGTACTTTGATCG
AGCGAAACCTGTGCTTGACCGAGTGAAACTGCTAATTTTTCTATCTGAAGTTCAGAGCAAACAATGGTTAACATGGTGTG
AAGAGGACCATATAAAGCTTAGGTCTCAGCCGGTTATTGTTCCGCTGTCTGTTAATGATGAGTTAGCTTTTGTTGCTGGG
ATTTACTCTTCACTAAATACTCCGACACTAACCCAAGAGATGATGAAGGAGAAAAGACAAAAGCTACGTGAATCAGTCAG
AACGGAGTTCGGTTTGACAGATAAGGATATGCTTGTGATGTCTCTTAGCAGCATAAACCCAGGAAAGGGACAACTTCTTC
TCCTTGAATCTGTCGCCTTGGCACTGGAGAGAGAACAAGAACAAGAGCAAGTAGCTAAAAGTAATCAACAGCCCAAAATC
AAGAACCTCAATGGCATCAGGAAAGAAAAGATTAGTCTTTCTGTAAAACATCGTTTAAGAGGTTCATTACGGAAGATGAA
AATCACGACTCCCGCTACTGACAATTCATCAGTTCTTTCTGCCACCGGTAAAAGAAAGCTGTTGTTTTCTGGAAACGTAA
CACAGAAACAAGACCTTAAACTTCTTCTAGGATCAGTTGGGTCCAAGAGCAACAAAGTTGCATACGTTAAGGAAATGTTG
AGCTTCTTGTCAAACAATGGAAACTTATCGAACTCGGTTCTGTGGACTCCAGCCACCACTCGTGTTGCCTCATTATACTC
TGCAGCAGATGTCTACGTCACAAACTCCCAGGGAATTGGTGAAACATTCGGGAGGGTAACTATTGAAGCAATGGCTTATG
GTCTTCCGGTACTTGGAACAGATGCTGGAGGAACAAAAGAGATAGTGGAGCACAATGTTACAGGGCTACTTCACCCTGTG
GGGAGGGCAGGTAACAAAGTTTTAGCTCAGAATCTCTTGTTTCTTCTTAGAAACCCATCTACAAGGCTACAACTAGGTAG
CCAAGGACGTGAAATCGTTGAGAAGATGTACATGAAGCAGCACATGTACAAGAGATTTGTGGATGTTCTAGTCAAATGTA
TGAGACCCTAA