Details for Lyrate rockcress Locus 16052445

Position : sca3 ( 5`- 5712877 .. 5715138 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052445

Protein [Map View]
MLLQFRAKKTSFNNIAQESLVILITKQVGLGYRFLSSLCQPKNTALDSEAYKKLFQTAAKSGSLVLGKLAHGHMVKSSLN
PCLYLLNNLLNMYCKCRELGFARQLFDRMPERNIISFNSLISGYTQVGFYEQAMELFLEARDDNLKLDKFTYAGALGFCG
ERCDLDFGKLLHGLVVVNGLSQQVFLINVLIDMYSKCGKLDQAMSLFDRCNERDQVSWNSLISGYVRVGAAEEPLNLLAK
MHRAGLKLTTYALGSVLKACCINLNEGLMEKGMAIHCYAAKLGMEFDIVVRTALLDMYAKNGSLKEAIKLFSLMPAKNVV
TYNAMISGFLQMDDITDEASSEAFKLFMEMQRRGLEPSPSTFSVVLKACSAAKTLEYGRQIHALICKNNFQSDEFIGSAL
IELYALMGSTEDGMQCFASTSKQDIASWTSIIDCHVQNEQLESAFDLFRQLFSSPIRPEEYTVSLMMSACADFAALSSGE
QIQGYAIKSGIDAYTSVKTSSISMYAKSGNMPLANKVFIEVQNPDVATYSAMISSLAQHGSAHDALNIFESMKTRGIKPN
QQAFLGVLIACCHGGLVTHGVNYFQTMKNSYGINPNEKHFTCLADLLGRTGRLSDAENLILSSGFQDHPVMWRALLSSCR
VYKDSVIGKRVAERLMELEPEASGSYVLLHNIYNDSGVNSSAEEVRELMRDRGVKKEPALSWIVLGNQTHSFAVADWSHP
SSQMIYTMLDTMNTVVDFVDHTLVHSRSVYMKI*

DNA
ATGTTGTTACAGTTCCGAGCAAAGAAGACTTCGTTCAACAACATTGCTCAAGAGTCTCTTGTTATTCTTATCACCAAACA
AGTTGGATTGGGTTACAGGTTTTTGTCTTCGTTATGCCAACCAAAGAACACGGCTTTAGATTCCGAAGCTTACAAGAAAC
TTTTTCAGACAGCTGCGAAATCAGGCTCCCTGGTACTGGGAAAGCTCGCCCATGGACACATGGTGAAGTCTTCCTTGAAC
CCGTGTCTGTACTTGCTCAACAATCTTCTGAATATGTATTGCAAGTGCCGGGAATTGGGTTTTGCACGCCAGTTGTTCGA
CAGAATGCCTGAACGGAACATTATTTCTTTTAATTCTTTGATTTCTGGGTACACTCAGGTGGGGTTTTATGAGCAGGCCA
TGGAATTGTTTCTTGAAGCTAGGGATGATAATTTGAAGCTTGATAAGTTCACGTATGCCGGTGCATTAGGCTTTTGTGGG
GAAAGGTGTGATCTTGATTTTGGCAAATTGTTGCACGGGTTGGTTGTTGTTAATGGTCTGTCTCAGCAAGTGTTTTTGAT
TAATGTGTTGATCGACATGTATAGTAAGTGTGGAAAGCTTGACCAAGCTATGTCTTTATTTGATAGATGCAATGAAAGGG
ATCAAGTTTCATGGAATTCTTTGATTTCTGGTTATGTTCGGGTTGGTGCAGCGGAAGAACCGCTTAATCTGTTGGCTAAA
ATGCATAGAGCCGGCTTAAAGTTGACTACTTATGCTCTGGGGAGTGTGCTAAAGGCTTGTTGCATAAACCTGAACGAAGG
ATTGATGGAAAAAGGTATGGCAATTCACTGTTACGCAGCAAAACTAGGAATGGAATTTGATATAGTTGTCCGTACTGCGT
TGCTTGACATGTATGCCAAAAACGGAAGTTTGAAGGAGGCGATAAAGCTTTTCAGTTTGATGCCTGCCAAGAATGTGGTT
ACGTATAACGCGATGATTTCTGGGTTTCTCCAAATGGATGATATAACCGATGAAGCTTCGAGTGAAGCCTTTAAGCTCTT
CATGGAAATGCAAAGACGGGGTTTGGAACCCTCGCCATCGACATTTTCAGTTGTGCTCAAAGCTTGTAGTGCGGCGAAAA
CCTTAGAATATGGAAGGCAGATTCACGCTCTCATCTGTAAGAACAATTTCCAGTCTGATGAGTTTATTGGAAGTGCTCTA
ATCGAGCTGTATGCATTAATGGGTTCAACTGAAGATGGAATGCAATGCTTTGCTTCAACATCAAAACAAGATATCGCCTC
ATGGACATCGATAATTGATTGTCATGTCCAAAACGAGCAGCTTGAAAGCGCATTTGACCTGTTCCGACAACTTTTTTCAT
CCCCTATAAGACCGGAAGAGTATACAGTTTCCCTTATGATGAGTGCTTGTGCAGATTTTGCTGCGTTAAGCTCAGGAGAG
CAGATTCAGGGTTATGCCATAAAGAGTGGAATTGATGCTTACACCAGTGTTAAGACCTCCAGCATTTCTATGTACGCAAA
GTCAGGTAACATGCCTCTTGCTAATAAAGTATTTATCGAGGTCCAAAACCCAGACGTTGCAACATACTCAGCTATGATCT
CAAGCCTTGCGCAACACGGTTCTGCTCACGATGCCTTAAACATCTTTGAGTCGATGAAAACCCGCGGAATTAAACCGAAC
CAGCAAGCATTTCTCGGCGTTCTAATAGCTTGTTGCCACGGAGGATTAGTCACACACGGAGTAAACTATTTCCAAACCAT
GAAGAACAGTTACGGGATTAACCCGAACGAGAAACATTTCACTTGCCTCGCCGATCTCTTAGGTCGCACCGGAAGATTAT
CAGATGCCGAGAACCTGATTTTGAGCTCTGGTTTTCAAGACCATCCAGTGATGTGGAGAGCATTATTGAGTTCTTGCAGG
GTATACAAAGACAGCGTAATTGGTAAACGCGTTGCAGAGAGATTGATGGAACTCGAACCTGAGGCCTCTGGCTCGTACGT
ATTGCTCCACAACATTTACAATGATTCTGGAGTCAATTCTTCAGCTGAGGAGGTTAGAGAGCTGATGAGAGATCGAGGGG
TTAAGAAAGAACCAGCCTTGAGCTGGATCGTGCTCGGTAACCAAACTCATTCCTTCGCAGTGGCTGACTGGTCTCACCCT
TCGAGCCAGATGATCTACACGATGTTAGACACCATGAACACTGTAGTAGATTTTGTAGACCACACTCTTGTTCATTCTCG
TTCTGTTTACATGAAAATTTAA