Details for Lyrate rockcress Locus 16052411

Position : sca3 ( 5`- 5781051 .. 5776301 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052411

Protein [Map View]
MVTGSRTSGNRGVGLDDESKKMIQSIKEIVGNHSDADIYTALKEANMDADEAVQKLIHQDPFHEVKRKRDRKKEGTVFVE
PANVKKPLENVTSEVKVRTQPEHNVRRGGYSRNFFPRNAAAQRNASPRNPAAGSNREFRVVRDNRSNPNVNEQLKHSSAQ
SSGSNINKVVATVNKLCSRGGLGNHSSSGAQDSTDDCNAPADGRLRQAEIAPLHRPISKELRGVTLPSTNSVLGVSSSTD
PVHVPSPVSRSSPVGAIKREVRGGGLGGKPSDNVGKAPSVPSFSGSSIRKSGPINAHRPSPSSPTSNIDHSRITARESVM
PSGVEKNRSFLNRQRGNRGSQYARTQQQVGGHTKGASQHKEWKPKSNQKPVGHNPGVIGTPTKSQGRSPANNSINVESEA
VKAHDKLPNVHISESQNVIIADHIRVPETDRCQLTFGSFVQEVNSSSNSTSAFQESWSSEELRESDRSSPVTCPEALTDG
PGVQPINNIDDHVRISGSDSPVSAVSEPQLPEQKETHRSDNLDDYSGIQLLNRNGPPYTPLEFEQQQDLPELQKISQAYD
NHGSYEFPYFIPAMDETVRVQGLPSPQEQGFSTHMVNNTPPSTIPMLQQQQQASMQQMYPQVHVSHFPNLMPYRQFLSPV
YVPQMPMPGYSGNPAAYAHPSNGNSYVLMPGGGSHLGSNGVKYGIHQQYKPVPTGGPTGFGTYNNPNGYPINPPNVVGNA
TGLEDPSRMKYKDVNIYVPNPQAETSEIWMQNPRDLSSLQSPYYNVAGQSPHGTYLSSHTAHQSFNPAAQSSHMQFQGLF
HPPQPGTMANPHHMGPGLGGNVGVGVVPSPPPSQVGTYQQSQLGHPNWPANF*

DNA
ATGGTGACTGGGTCCAGAACTAGCGGTAATCGTGGGGTAGGACTCGATGATGAATCGAAAAAGATGATTCAATCGATTAA
GGAAATTGTGGGTAATCACTCAGATGCTGATATTTACACTGCCTTAAAAGAAGCTAACATGGACGCTGACGAGGCTGTGC
AGAAGCTGATTCATCAAGATCCATTCCACGAGGTGAAGAGAAAAAGAGACAGGAAAAAAGAGGGTACAGTATTTGTTGAG
CCTGCAAACGTAAAGAAACCTCTTGAAAATGTTACCAGTGAAGTGAAGGTTCGTACACAGCCTGAACATAATGTTCGGAG
AGGAGGCTACAGTAGGAATTTCTTCCCCAGGAACGCCGCTGCTCAACGAAATGCATCTCCTAGAAATCCTGCTGCTGGAT
CCAACAGAGAGTTTCGCGTTGTTAGGGACAACAGGTCTAATCCAAATGTCAATGAACAGTTGAAGCATTCTTCTGCCCAG
TCCTCTGGATCAAATATTAACAAAGTGGTGGCCACTGTGAACAAATTGTGCTCAAGAGGTGGTTTGGGAAATCATAGCTC
TTCAGGGGCTCAAGATTCTACTGACGATTGTAATGCTCCAGCAGATGGCAGGCTCAGACAGGCTGAAATTGCTCCTTTGC
ACCGTCCTATCAGTAAAGAACTCCGTGGAGTTACTTTGCCATCAACCAATTCAGTTCTTGGTGTATCGTCTTCCACAGAT
CCAGTTCATGTACCATCTCCTGTTTCTAGATCATCACCCGTGGGAGCTATTAAACGTGAAGTAAGGGGTGGAGGTTTAGG
TGGAAAACCTTCTGATAATGTTGGTAAAGCTCCATCTGTGCCCTCTTTTTCAGGGTCCTCTATTAGAAAAAGTGGACCTA
TAAATGCACATCGACCATCACCATCTTCCCCAACTTCAAATATTGATCACAGTCGAATTACTGCACGAGAGTCTGTTATG
CCCAGTGGTGTGGAAAAGAATAGGTCATTTTTGAACAGACAGCGTGGGAATAGAGGAAGTCAATATGCTAGAACACAACA
ACAAGTTGGTGGCCATACAAAGGGAGCCTCACAGCACAAGGAGTGGAAGCCTAAATCAAATCAGAAACCTGTTGGACATA
ACCCTGGAGTAATTGGAACACCTACAAAGTCTCAAGGTCGTAGTCCTGCTAATAATTCCATAAATGTGGAATCAGAAGCC
GTTAAGGCACACGATAAGCTTCCGAATGTTCATATAAGTGAAAGTCAGAATGTCATCATCGCAGATCATATTCGTGTCCC
GGAAACTGACCGCTGTCAGCTTACTTTTGGTAGCTTTGTTCAAGAGGTTAATTCTTCAAGTAATTCAACATCTGCTTTCC
AAGAATCATGGTCTTCAGAAGAACTTAGAGAATCTGATCGTAGTTCGCCAGTTACTTGTCCTGAGGCTTTAACAGATGGT
CCAGGCGTTCAGCCTATCAATAATATTGATGATCATGTCAGAATTTCTGGATCTGACTCACCCGTCTCAGCAGTATCTGA
GCCACAGTTGCCCGAACAGAAAGAAACTCATAGATCTGACAATTTGGATGATTACTCGGGAATTCAATTACTCAATAGGA
ATGGTCCACCTTATACTCCTTTAGAGTTTGAACAGCAGCAAGATCTTCCCGAGTTGCAAAAAATTTCTCAGGCTTATGAC
AACCATGGTAGTTATGAATTTCCGTATTTTATACCTGCAATGGATGAAACCGTACGAGTTCAAGGATTACCATCTCCACA
GGAGCAGGGATTCAGTACTCACATGGTAAATAATACCCCTCCATCCACTATTCCCATGTTGCAGCAACAACAACAGGCAT
CAATGCAACAGATGTATCCGCAGGTCCATGTTTCACATTTTCCCAATCTCATGCCTTATCGTCAATTCCTCTCCCCAGTC
TATGTTCCCCAAATGCCCATGCCAGGCTACTCAGGTAACCCAGCAGCATATGCACACCCTTCAAATGGCAATAGCTATGT
GCTGATGCCTGGAGGCGGTTCTCATCTCGGTTCAAATGGTGTCAAGTATGGAATCCATCAGCAATATAAACCAGTTCCAA
CTGGTGGACCTACGGGTTTTGGGACTTACAACAATCCTAATGGGTATCCAATTAATCCTCCCAATGTTGTTGGAAACGCT
ACGGGACTGGAAGATCCATCTCGCATGAAATACAAAGATGTAAATATTTACGTTCCAAATCCTCAGGCTGAGACTTCTGA
GATTTGGATGCAAAATCCAAGAGATCTTTCAAGCCTTCAGTCTCCATATTACAATGTAGCTGGACAATCGCCTCATGGCA
CTTATTTATCGTCCCATACAGCACACCAATCGTTCAACCCTGCTGCGCAATCATCTCACATGCAGTTCCAGGGTCTCTTC
CACCCACCACAGCCTGGCACAATGGCGAATCCGCACCACATGGGACCTGGCCTTGGTGGTAATGTTGGAGTCGGGGTTGT
GCCCTCTCCTCCTCCGTCTCAAGTTGGTACCTATCAACAATCACAACTTGGTCATCCGAATTGGCCAGCAAACTTCTGA