Details for Lyrate rockcress Locus 16052351

Position : sca5 ( 5`- 17985169 .. 17991400 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052351

Protein [Map View]
MSSVRNTHWCHRCQRAVWLRARDAVCSYCGGGFVEEIDLGPSSPFDLLRAHRDVDRDPTFDLMEAFSAFMRSRLAERSYD
REISGRIGSAGSESFSNLAPLLIFGGQAPFRLAGGDNNSVEAFVNGAAPGIGITRGTNAGDYFFGPGLEELIEQLSSGTH
HRGPPPAPKSSIDALPTIKITQKHLKSSDSHCPVCKDDITHAQSVAKSYHQEDLLQAHRVVRTEAPMEEKTAEEGIFSLT
SGHSARLAQARPKTAETQTTQPLQKKATTIILITSSNSNNINITNNNPIWVTVDGLLTIKVFSVNESVFVMGKNTDAEQN
LPVSDGAASARNNGGGRSRCYCCDWISSYFSLRCVLILAFSAAVFLSALFWLPPFLGFADREDLDLDPRFKDHRIVASFD
VGKPVSFMEDNLLQLENDITDEISFPMTKVVVLALERLGDLNRTMVIFAIDPEKENSKIPAEIESLIKAAFETLVQKQLS
LRLTESLFGEPFFFEVLKFPGGITVIPPQPIFPLQKAQLLFNFTLNFSIYQIQSNFEELASQLKKGINLAPYERFNSVAP
YYSSFFCSAYSRFVFEVEATCSNYH*

DNA
ATGTCAAGTGTTCGGAATACTCATTGGTGTCACAGATGTCAACGTGCTGTTTGGCTTCGAGCTCGAGATGCTGTCTGTTC
ATATTGTGGGGGAGGATTTGTTGAGGAAATCGATTTAGGACCGAGTAGCCCGTTTGATCTGCTTAGAGCTCACAGGGATG
TTGACCGTGATCCAACCTTTGATCTCATGGAAGCTTTCTCAGCCTTTATGAGAAGCCGTTTAGCTGAAAGAAGCTATGAC
CGAGAAATCAGCGGAAGAATTGGATCTGCGGGTTCTGAAAGCTTCTCAAACTTAGCTCCTTTATTGATCTTCGGTGGCCA
AGCTCCCTTTAGATTGGCTGGTGGTGATAATAATTCAGTTGAAGCCTTTGTCAATGGCGCAGCACCTGGGATTGGTATCA
CACGTGGCACTAATGCCGGAGACTATTTTTTCGGACCCGGACTTGAAGAACTGATTGAACAACTTTCGTCAGGCACTCAT
CACAGAGGCCCACCACCAGCACCAAAATCATCAATTGATGCATTGCCAACCATCAAGATCACACAGAAGCATCTCAAGTC
ATCAGACTCTCACTGCCCGGTTTGCAAAGACGACATAACTCATGCCCAGTCTGTCGCAAAGAGTTACCATCAAGAGGATC
TTCTTCAAGCACACAGAGTAGTCAGAACAGAAGCACCAATGGAAGAGAAAACAGCAGAAGAAGGAATATTTTCTCTAACC
TCTGGCCATTCCGCTCGTCTAGCTCAAGCTCGACCCAAAACCGCAGAGACACAAACAACACAACCACTGCAGAAGAAGGC
CACTACCATCATACTCATCACCAGCAGCAACAGCAACAACATCAACATCACCAACAACAATCCCATATGGGTTACAGTGG
ATGGCCTTTTGACTATTAAAGTTTTTTCTGTGAATGAATCTGTGTTTGTTATGGGGAAAAATACCGACGCGGAGCAGAAT
CTTCCTGTGAGCGACGGAGCTGCTTCGGCTAGGAATAACGGAGGAGGAAGAAGCAGATGTTATTGCTGCGATTGGATCTC
TAGCTACTTTAGTCTCAGATGCGTTTTGATTCTTGCTTTCTCTGCTGCTGTGTTTCTCTCCGCCTTGTTTTGGTTACCTC
CATTCCTCGGATTTGCAGATCGAGAGGATCTAGATCTCGATCCAAGGTTTAAAGATCACAGAATTGTGGCGAGTTTTGAT
GTTGGAAAACCAGTTTCGTTCATGGAGGACAATTTGCTGCAGCTTGAAAATGATATCACCGATGAAATAAGCTTTCCCAT
GACCAAAGTTGTGGTATTAGCGCTTGAACGATTGGGTGATCTTAACAGAACAATGGTTATTTTTGCCATTGATCCCGAGA
AGGAGAATTCTAAGATACCTGCCGAAATAGAGAGTCTGATCAAGGCAGCTTTTGAAACACTGGTCCAGAAGCAGTTGTCT
CTCCGTTTGACTGAATCCTTATTTGGGGAACCATTCTTTTTCGAGGTGCTAAAATTCCCTGGAGGAATCACTGTGATCCC
TCCCCAGCCTATATTTCCCCTGCAGAAGGCGCAACTTCTCTTCAACTTCACACTAAACTTTTCGATTTACCAAATTCAAT
CAAACTTTGAGGAACTCGCTAGCCAGCTGAAGAAGGGCATAAATCTGGCTCCCTATGAGAGGTTCAACAGTGTCGCCCCC
TACTATAGTTCATTCTTCTGTTCTGCTTACAGTCGGTTCGTCTTCGAGGTTGAAGCAACTTGCTCAAACTATCACTAG