Details for Lyrate rockcress Locus 16052290

Position : sca5 ( 5`- 17954093 .. 17951556 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052290

Protein [Map View]
MTKVCPEIEEGTLSLSVVPVSVDVSFASNHFPTYKLGPDNQIVEEPKEDEKGPSVKETVDKESELLSDQHKRLSVRDLAS
KFDKNLAAAVNLADEAKLREVASLEGHVMLKKLRDALEYMRGRTDGQNKEDVETAISMVEALAVKLTQNEGELIQEKFEV
KKLGNFLKQTSEDAKKLVNQEKSFACAEIETARAVVLRLGEAFEEQERISEASRAQGPNVEKLVEEVQEARQIKRMHHPT
KVMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGKQSLGSCLRIRVNAADNAPDLSNCSIQWYRAA
CETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKFTVTTDDPVDPDSSLQSRVESLMRKSNSEFSVVISQMNGQDY
ASRSHVFTVGKTRIKLSRGWITKARELYSTSMQLCGVRGNIKAPTKAVFWQPRKSLTFILTFESEQERNAAIALARKYAF
DCNVTLLGPDD*

DNA
ATGACGAAAGTGTGTCCTGAAATAGAAGAAGGGACATTATCTTTATCAGTTGTTCCAGTATCAGTAGATGTGAGCTTTGC
TTCTAATCATTTTCCAACATACAAATTAGGACCTGATAATCAGATAGTAGAGGAACCTAAGGAAGATGAAAAAGGTCCAT
CAGTCAAAGAGACCGTCGATAAAGAGAGCGAGCTGTTGTCTGATCAGCACAAGCGGCTTTCGGTCCGTGACCTCGCTAGT
AAATTCGACAAGAATCTGGCTGCAGCTGTTAATTTGGCTGATGAGGCTAAATTAAGAGAGGTGGCTTCTTTGGAGGGACA
TGTTATGTTGAAGAAGCTAAGGGATGCTTTAGAATACATGAGAGGACGCACGGATGGGCAAAACAAGGAAGATGTGGAGA
CAGCTATCTCCATGGTTGAAGCTCTAGCTGTGAAGTTAACTCAGAATGAAGGTGAATTGATTCAAGAGAAGTTTGAAGTG
AAGAAACTAGGAAACTTCCTCAAGCAGACTTCAGAAGATGCAAAGAAACTGGTAAATCAGGAAAAGTCGTTCGCTTGTGC
TGAGATCGAAACTGCTAGGGCCGTTGTGCTGAGACTTGGAGAGGCTTTTGAAGAACAAGAACGGATTTCTGAAGCTTCTA
GAGCTCAGGGGCCGAATGTGGAGAAATTGGTTGAGGAGGTTCAAGAGGCTAGGCAAATCAAACGGATGCATCACCCAACA
AAGGTGATGGGCATGCAACACGAACTTCATGGTTTAAGAAATCGAATCCAAGAGAAGTATATGAATTCTGTTAAACTTCA
TAAAGAGATAGCAATAATCAAAAGAGTTGAGGAATCCAAGTCCTGTCCATTTGTTCTTGAAGGCAAGCAAAGTCTTGGCT
CTTGCTTAAGAATCCGTGTCAATGCTGCAGACAATGCTCCAGATCTTTCCAACTGTTCGATTCAATGGTATCGTGCAGCA
TGTGAAACTAGTAGAAGGGAAGCTATATCTGGTGCCATCCAATCGATGTATGCTCCAGAACCATTTGATGTTGGGAGGAT
CTTACAGGCAGACATTCTTTCAAATGGACAAAAGTTCACAGTTACAACAGATGATCCAGTTGATCCTGATTCTAGCTTGC
AATCACGCGTAGAGTCTCTGATGCGAAAATCTAACAGTGAATTCAGTGTGGTTATATCGCAGATGAATGGACAGGACTAT
GCATCCCGGTCTCACGTCTTTACCGTTGGAAAGACGAGGATAAAGCTGTCTCGAGGATGGATCACAAAGGCGAGAGAATT
ATATTCGACATCCATGCAGCTCTGTGGAGTTAGAGGCAATATTAAAGCTCCTACCAAGGCAGTGTTCTGGCAACCAAGAA
AGAGTCTAACATTCATACTAACCTTTGAGTCAGAACAAGAACGTAACGCAGCCATAGCCCTGGCTCGAAAATACGCTTTC
GATTGCAATGTTACACTGCTTGGTCCAGATGATTAA