Details for Lyrate rockcress Locus 16052177

Position : sca3 ( 5`- 6680179 .. 6679589 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052177

Protein [Map View]
MSGSVFVPGMAIGVPTLSRSSSAHRSLEPTKKMIMTNVKFVTIFRNPSSCSGTKRSFRVTASNDRSEQADNGQGVQEDLN
YLLKIGVGSVAGAAIIKYGSVLFPQITRPNLTLALFIIMAPVVISVILLFLSSSSSKKHN*

DNA
ATGTCAGGTTCTGTTTTCGTTCCCGGTATGGCGATTGGAGTTCCGACGCTTTCTCGTTCGAGCTCTGCTCACCGGAGCTT
GGAACCCACGAAGAAGATGATAATGACTAATGTCAAATTCGTGACCATTTTTCGAAATCCGTCAAGCTGTTCAGGGACAA
AACGGTCATTTCGCGTTACTGCTTCCAATGACCGGTCGGAACAAGCAGATAACGGTCAAGGAGTTCAGGAGGACTTAAAC
TACTTGTTGAAGATCGGAGTTGGTTCAGTGGCAGGCGCAGCTATAATCAAATACGGAAGTGTCTTGTTCCCACAGATCAC
AAGACCTAATCTCACTCTAGCCCTCTTCATTATCATGGCTCCTGTTGTAATCTCTGTTATCCTTTTGTTCCTATCATCAT
CATCATCCAAGAAACACAACTGA