Details for Lyrate rockcress Locus 16052070

Position : sca3 ( 5`- 12300462 .. 12301362 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480001 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16052070

Protein [Map View]
EAESQKRIFCLFPRKIRSSLVKRQQNLNGLLHRLSILTSSLLILRETKTLQNPSSESCSSLVLFDYKMAESEKTETKDPL
NPLSLGLSENTSRKRRAVKERKRTGGFKKAKVAPFPRTARETPEWLVKVMSDMKEAKDAKLIFEKTLFVTDVNPTQNRLS
MPFNNLLRNDFLTSVESRIIDKDINNDKKIGVGAILVDQRSEKWGVMLKRWEMKKESGKGSWNYNLICGWNDIVEANGLK
DGDNISLWSFRCCGILCFAMEQSSSSLALCLC

DNA
GAAGCAGAAAGCCAGAAGAGAATCTTTTGTCTCTTCCCGAGAAAAATAAGATCGTCTTTGGTGAAGAGACAACAAAACCT
TAATGGACTTCTACATCGCTTATCGATCTTAACCAGTTCCCTACTGATTCTGAGAGAGACGAAAACACTACAAAACCCTA
GTTCTGAATCTTGTTCTTCACTCGTACTCTTTGATTACAAGATGGCTGAGTCCGAGAAGACAGAGACGAAAGACCCACTA
AACCCTCTGTCTTTGGGCCTATCGGAGAACACAAGCCGCAAGAGACGTGCCGTAAAAGAGAGGAAGCGTACTGGTGGATT
CAAGAAAGCAAAGGTTGCTCCTTTTCCACGGACAGCGAGAGAGACGCCTGAGTGGCTTGTCAAGGTGATGAGTGACATGA
AAGAAGCTAAAGACGCTAAACTGATCTTTGAGAAGACTCTGTTCGTGACTGATGTAAACCCAACACAGAACCGTCTCTCA
ATGCCTTTCAACAACTTACTCCGCAACGATTTCTTGACGTCTGTGGAGTCCAGAATCATAGACAAAGACATCAACAACGA
TAAGAAGATTGGAGTGGGAGCGATTCTCGTGGATCAACGGTCTGAGAAGTGGGGTGTGATGTTGAAGAGATGGGAGATGA
AGAAGGAATCAGGTAAAGGAAGCTGGAATTACAATTTGATTTGTGGGTGGAACGATATCGTTGAGGCTAACGGATTGAAA
GATGGCGACAACATTAGTCTTTGGTCGTTTAGGTGTTGTGGAATCCTCTGCTTTGCCATGGAACAGAGTAGCTCTTCCCT
TGCTCTCTGTCTCTGCT