Details for Lyrate rockcress Locus 16052030

Position : sca3 ( 5`- 9934442 .. 9937889 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16052030

Protein [Map View]
MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMEIGGLDDDGVIAPVLGHADDDEYHLFDKGEGAGLGSLSDM
DDLATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTHDAELTSWLDEQDQEAKRWSSQPQSFAHSKPLYRTSSY
PQQQPQLQHYNSEPIILPESNFTSFPPSGSRSPQASPGNLHRAPSLPGGSQLTYSAPSPLSNSGFHLSGLSQGPHYGGNL
ARYASCGPTLGNMVQPHWVTDPGLLHGDHSGLLHNLVQQQHQQLPPRNAIMSQHLLALQQRQSYAQLAALQSQLYSSYPS
PSRKVPFGVGEVREHKHKSSHRSRKNRGLSQQASDAASQKSESGLQFRSKHMTSEEIEGILKMQHSNSHSNDPYVNDYYH
QAKLAKKSAGSKAISHFYPAQLKDHQPRSRNSSEQHPQVHVDALGKITLPSVRRPHALLEVDSSPGFNDGSGDHKGSGKH
LEQEPLVAARVTIEDALGVLIDIVDIDRTLQNTRPQDGGAQLKRKRQILLEGLATALQLADPFSKTGQKSGMTAKDDIVF
LRIATLPKGRKLVTKYLQLIVPGTEIARVVCMAIFRHLRFLFGGLPSDTLAAETISNLAKAVTVCVQAMDLRALSACLAA
VVCSSEQPPLRPIGSSAGDGASVVLISLLERAAEVVVVPRVMHGNSNDGLWRASFDEFFNLLTKYCRSKYETIRGQNQGS
AADVLELAIKREMPAELLRASLRHTNDDQRNYLLNFGHKPSAISESASHARGGQINSESVRG*

DNA
ATGGAGAGATCTGATTCAAGGGATTTGTATAACTTTGTTCGCGCTTCTTCCTTAGATAAAAACAGTACACTCTTCGATGC
ATCACAATATGAGTTTTTTGGTCAGAATCTGGATGATATGGAAATTGGGGGTCTGGACGATGATGGAGTGATCGCTCCTG
TTCTTGGACATGCTGATGATGATGAGTATCACTTGTTTGATAAAGGAGAGGGGGCAGGTTTAGGATCACTATCCGACATG
GATGATCTTGCGACAACTTTCGCAAAGTTAAACAGAGTTGTTACCGGACCCAAACACCCGGGAGTTATTGGTGATAGAGG
ATCAGGATCCTTTTCAAGAGAGAGTTCTTCTGCTACCGATTGGACACATGATGCAGAGCTCACAAGCTGGTTGGACGAAC
AAGATCAAGAAGCTAAGAGATGGTCCTCACAGCCACAATCATTTGCTCATTCAAAACCTTTGTACAGGACATCTTCCTAT
CCTCAGCAGCAACCGCAGCTGCAGCACTACAATAGTGAACCGATAATTTTACCAGAATCAAATTTTACCTCCTTTCCCCC
GTCTGGTAGCAGATCTCCACAGGCGTCACCCGGAAATCTCCATCGTGCTCCTTCTCTTCCTGGTGGTTCTCAGTTGACTT
ATTCTGCACCTTCCCCACTGTCAAATTCTGGTTTTCATCTTTCAGGATTGTCGCAAGGGCCCCACTATGGTGGTAATTTG
GCTAGATATGCCTCATGCGGTCCTACGCTTGGTAACATGGTGCAACCTCATTGGGTCACTGATCCTGGTCTTCTACACGG
AGATCATTCTGGTTTATTACATAATCTGGTGCAACAGCAGCATCAACAATTGCCTCCTCGAAATGCTATTATGTCGCAAC
ATTTGCTCGCCCTCCAGCAGAGACAATCGTATGCTCAACTTGCGGCGCTACAGTCCCAACTGTATAGTTCCTATCCTTCG
CCATCACGTAAAGTCCCTTTTGGGGTTGGTGAAGTTAGGGAACACAAACATAAGTCATCTCATAGAAGTCGAAAGAACAG
AGGCCTCTCTCAACAGGCGTCAGACGCAGCTAGTCAGAAAAGTGAAAGTGGACTGCAGTTTAGATCAAAGCACATGACTT
CAGAAGAAATAGAGGGTATACTCAAGATGCAGCATTCCAATTCACACAGCAATGATCCCTATGTCAATGATTATTACCAC
CAAGCTAAGCTTGCCAAGAAGTCTGCCGGATCTAAAGCAATCTCTCACTTCTATCCTGCTCAGTTGAAGGACCACCAGCC
TCGGTCCCGTAATAGTTCTGAACAGCATCCACAAGTTCATGTAGATGCTCTTGGTAAGATTACACTTCCTTCTGTCCGCA
GGCCACATGCCTTGCTCGAGGTTGACTCTTCTCCTGGTTTTAACGATGGAAGCGGGGATCATAAGGGCTCAGGAAAACAT
TTGGAACAGGAACCTCTCGTTGCAGCTAGGGTTACAATTGAAGATGCTCTTGGAGTTCTTATTGACATAGTTGACATTGA
CAGAACTCTCCAAAACACAAGACCCCAGGACGGAGGTGCCCAACTCAAGAGAAAGCGGCAGATCCTGCTAGAAGGATTAG
CGACAGCACTTCAACTTGCTGATCCGTTCAGCAAAACCGGTCAGAAATCCGGGATGACTGCTAAGGATGATATTGTCTTT
CTACGTATAGCGACTCTCCCCAAGGGTCGAAAATTGGTTACAAAGTATCTACAACTTATAGTTCCAGGTACTGAGATTGC
TCGAGTTGTCTGTATGGCTATATTCCGCCACTTGAGATTTCTGTTCGGCGGCCTGCCTTCAGATACTCTAGCAGCAGAGA
CGATATCTAATCTTGCCAAAGCAGTCACAGTTTGCGTTCAAGCCATGGACCTTCGAGCACTGAGTGCTTGCCTTGCAGCT
GTAGTTTGTTCTTCAGAGCAGCCACCTCTGCGTCCTATTGGAAGTTCTGCTGGGGATGGTGCTTCAGTTGTCTTGATATC
TCTTCTTGAGAGAGCTGCTGAAGTAGTGGTGGTTCCTCGAGTCATGCATGGGAATTCTAATGATGGTCTCTGGAGAGCCT
CATTTGATGAATTCTTCAACCTTCTTACCAAATACTGCAGAAGCAAGTATGAGACAATCCGCGGACAGAACCAAGGGAGT
GCAGCGGATGTTTTGGAGCTGGCGATAAAGAGGGAAATGCCCGCTGAGCTTTTACGTGCGAGTCTGCGTCACACCAATGA
CGACCAGAGGAACTATTTATTAAACTTTGGTCATAAACCGTCGGCAATTAGTGAGTCGGCGTCTCATGCAAGGGGTGGAC
AGATCAACTCCGAATCTGTGAGAGGTTAA