Details for Lyrate rockcress Locus 16051981

Position : sca3 ( 5`- 3308329 .. 3310011 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896965 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051981

Protein [Map View]
MMTRRRPDSDIIQVSDENRSLGLFKEDEDEKIRDLGLVDETETRHASTNLLLQCHDGSCCLHKDKSNSFVSCRRNLDDLF
SGFVYKGVRRRKMDDFGSKTTSNLLSPQIADDDDSVAESHIERQDCSEFHVEVRRVSPYFQGSTVSQQSKEECDSDSVCS
QSGRNCSKVQAKVPIVSPYFQSSTISQCGSDIVSSSQSGKNYRRGSSKRQAKVRRDSPYFQESTVSEQPSQAPPRDLRQY
FKVVKVSRYFHADGIQVNESQKEKSTRVRKTPVVSPSLSLSQKTDEAYQRKTPDKTWVPPRSPCNLLQEHHWHDPWRVLV
ICMLLNKTSGAQTRGVIEDLFALCPDAKTATEVEEREIESLIKPLGLQKKRARMIQRFSLEYLQESWTHVTQLHGIGKYA
ADAYAIFCNGNWDRVKPDDHMLNYYWEFLRIRYKL*

DNA
ATGATGACTCGTCGGAGACCCGACTCCGATATTATCCAGGTAAGTGATGAGAATCGCTCGTTGGGTTTATTTAAGGAGGA
TGAAGATGAAAAAATTCGAGATTTGGGTTTAGTTGATGAGACTGAAACTAGACATGCTTCCACTAATTTGCTTCTTCAAT
GTCATGATGGTAGTTGTTGCCTCCACAAGGATAAGAGCAATAGCTTTGTTTCATGTAGACGAAACTTGGATGATTTGTTC
TCTGGGTTCGTTTATAAGGGTGTGAGGAGGAGGAAAATGGATGACTTTGGAAGTAAAACAACAAGTAATCTTTTGTCTCC
TCAAATTGCTGATGATGATGATAGTGTTGCTGAATCACATATTGAAAGGCAAGACTGCAGTGAATTTCATGTTGAAGTAA
GAAGAGTTTCTCCATACTTCCAGGGATCAACTGTTTCACAACAGTCTAAAGAAGAGTGTGATTCTGATAGTGTTTGTTCT
CAAAGTGGAAGAAATTGCAGCAAAGTTCAAGCTAAAGTCCCAATAGTTTCTCCATACTTCCAGTCATCAACTATTTCACA
ATGTGGTTCTGACATTGTTTCTTCTTCTCAAAGTGGAAAGAATTATAGGAGAGGAAGCAGCAAACGTCAAGCTAAAGTCC
GAAGAGATTCGCCTTATTTCCAGGAATCAACTGTTTCAGAACAGCCAAGCCAGGCTCCTCCTAGAGATTTGCGTCAGTAT
TTTAAGGTCGTGAAAGTTTCAAGATATTTCCATGCGGATGGAATTCAAGTCAATGAATCACAAAAGGAGAAATCAACAAG
GGTGAGAAAAACTCCTGTTGTGAGCCCTTCACTTTCGCTTTCTCAGAAGACCGATGAGGCATACCAGCGGAAAACGCCGG
ATAAAACGTGGGTGCCTCCACGATCTCCATGTAATCTACTTCAAGAACATCATTGGCATGATCCATGGCGGGTGCTGGTC
ATATGTATGCTTCTCAACAAAACATCTGGTGCACAGACGCGGGGAGTGATAGAAGACTTGTTTGCATTGTGTCCTGATGC
AAAGACTGCAACAGAAGTTGAAGAAAGGGAGATAGAGAGTCTAATAAAACCTCTTGGACTACAAAAGAAGAGAGCCAGAA
TGATTCAACGGTTTTCTCTGGAGTATCTTCAAGAGAGCTGGACTCATGTCACTCAACTTCATGGCATTGGAAAGTATGCA
GCGGATGCATATGCTATATTTTGTAACGGGAATTGGGATCGTGTGAAGCCTGATGATCATATGCTAAACTACTACTGGGA
ATTTCTCAGGATTCGGTATAAATTATGA