Details for Lyrate rockcress Locus 16051967

Position : sca2 ( 5`- 16582102 .. 16583453 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051967

Protein [Map View]
MFRWKTSSQTEQEHNETALREAKMKELKALIGQLSGRSSLYCSDACLKRYLEARNWNVGKAKRMLEETLKWRSTFKPEEI
QWNEVSGEGETGKVYKAGFHDRHGRTVLILRPGLQNTKSLENQMKHLVYLIENAILNLPEDQEQMSWLIDFTDWSMSTSV
PVKSARETINILQNHYPERLAVAFLYNPPRIFEAFWKIVKYFIDAKTFVKVKFVYPKNPESVELMSTFFDEENLPTEFGG
KALLQYNYEEFSKQMNQDDVKTANFWGLGHSNNNQLHVSNGFSGAEIAPEPIQTHP*

DNA
ATGTTTCGTTGGAAGACTTCTTCGCAAACCGAACAAGAGCATAATGAGACAGCTCTCAGAGAGGCAAAGATGAAAGAGCT
TAAGGCTCTCATAGGTCAGCTCTCTGGAAGGAGTTCACTGTATTGTTCAGATGCATGTCTGAAGAGATATCTGGAAGCTA
GGAATTGGAACGTAGGCAAAGCCAAAAGGATGCTCGAGGAGACGCTTAAATGGCGATCGACTTTTAAACCCGAGGAAATT
CAATGGAATGAAGTTTCAGGTGAAGGTGAGACTGGTAAAGTTTACAAAGCTGGATTCCATGACAGGCATGGAAGAACGGT
TCTTATACTGAGACCCGGCTTGCAGAACACAAAATCGTTGGAGAACCAGATGAAACATCTGGTGTATCTCATTGAGAATG
CTATTTTGAATCTGCCAGAGGATCAAGAACAGATGTCTTGGCTTATTGACTTCACGGACTGGTCAATGAGCACTAGTGTG
CCTGTTAAATCTGCCAGAGAAACTATAAATATACTGCAAAATCACTACCCAGAGAGACTAGCTGTAGCGTTCCTTTATAA
TCCTCCAAGAATCTTTGAGGCATTCTGGAAGATTGTGAAGTACTTCATTGATGCAAAGACATTTGTCAAGGTGAAATTTG
TTTACCCAAAGAACCCGGAAAGCGTGGAGCTTATGAGCACATTTTTCGACGAGGAAAATCTCCCAACTGAATTTGGAGGG
AAAGCTTTGTTGCAGTATAACTATGAAGAATTCTCCAAGCAAATGAACCAAGACGATGTTAAAACTGCAAACTTTTGGGG
ATTGGGTCACAGTAACAATAACCAGCTGCACGTGAGCAACGGGTTTTCTGGAGCCGAGATTGCCCCTGAGCCAATCCAAA
CCCACCCTTGA