Details for Lyrate rockcress Locus 16051726

Position : sca3 ( 5`- 5697705 .. 5697497 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051726

Protein [Map View]
MSVKPTVALRGILVGGVAIFAKVAAAMKAAGGVKLGAAATAMTVAATAAVSGGSKQDQKQDASKAPPPS

DNA
ATGTCGGTGAAACCCACAGTCGCTTTGAGAGGTATCTTAGTAGGTGGAGTGGCTATATTTGCAAAAGTCGCGGCTGCAAT
GAAAGCAGCTGGAGGTGTTAAGCTTGGTGCAGCTGCTACAGCTATGACCGTAGCTGCAACCGCTGCTGTGAGTGGAGGAT
CTAAGCAAGATCAAAAGCAAGATGCTTCCAAGGCACCACCACCTTCTAA