Details for Lyrate rockcress Locus 16051719

Position : sca3 ( 5`- 7215801 .. 7216561 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051719

Protein [Map View]
MAKQDGTSSSNTILPLVGSEFVRPQLLDLTITGDTVKDATGNRVFKVKTPLFGLHNKRILVDPNDSPIVTMKMKVTSKHD
RWQVYRGSDLDDKIFTVKRSSTVQLKTRVEVFLKHNQTKESSCDFTIKGRFMKRACTIYVGDSTKIIAQVYEGDERLVAT
VYPNVDYAFIVTLIFIFDLINNGGTAI*

DNA
ATGGCAAAACAAGATGGGACTAGCAGCAGCAACACGATACTACCACTCGTAGGATCTGAGTTTGTTCGTCCTCAACTCTT
AGATCTAACGATAACCGGAGATACAGTGAAGGACGCAACCGGGAACAGAGTGTTCAAAGTCAAAACGCCTCTCTTTGGTC
TCCACAACAAAAGAATTTTGGTTGATCCTAATGACTCTCCCATTGTCACCATGAAAATGAAGGTGACTAGTAAGCACGAT
CGATGGCAAGTGTATAGAGGAAGTGATTTAGATGATAAGATCTTCACGGTTAAAAGATCTTCGACTGTTCAATTGAAGAC
AAGAGTTGAAGTATTCTTGAAACATAACCAGACCAAAGAATCGTCTTGTGATTTCACAATCAAAGGTCGCTTTATGAAAC
GTGCTTGTACTATCTATGTTGGAGATTCTACCAAAATCATCGCTCAGGTATATGAAGGAGATGAGAGACTAGTGGCTACA
GTTTATCCTAATGTCGATTATGCTTTCATTGTCACACTAATCTTTATATTTGACCTCATCAATAATGGTGGGACTGCGAT
CTGA