Details for Lyrate rockcress Locus 16051715

Position : sca3 ( 5`- 4549870 .. 4550067 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051715

Protein [Map View]
MKPGFRFKYYSSKVEVRRNSNSTRLNCVECGNRCPRYIYYKNDNSVTVTCSLNCLEKKLIPLKTF*

DNA
ATGAAGCCTGGTTTCAGATTCAAGTATTACTCGTCTAAAGTCGAAGTTCGTCGCAACAGTAACAGCACTCGACTGAATTG
TGTTGAATGTGGTAATCGTTGTCCACGTTATATATACTACAAAAATGATAACTCTGTAACGGTTACTTGTTCTTTGAATT
GTTTAGAGAAGAAGCTGATTCCGCTGAAGACATTTTGA