Details for Lyrate rockcress Locus 16051682

Position : sca3 ( 5`- 10047606 .. 10049585 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051682

Protein [Map View]
MGSVPDPGELTELAQPSFEEFQKQTSLMTSCTLLWQELSDHFTSLEQNLMKKSEALKQMIETLDNQTQTSLESLKRREVT
IDHSVEIVAGKVGERARAALESLEKARDGGDGSNDDSGEVDDEEGLLSALKSLCLKMDARGFWNFVTARKKELENLRSKI
PAALVDCVDPAMLVLEAISEVFPVDKRGDKVSNDYGWACVVILESLTPVMVDPVIGKSRLLVTPSVKEKAKEIAETWKAS
LEERGRIENVKTPDVHTFLQHLVTFGIVKSEDLALYRKLVVGSAWRKQMPKLAVSVGLGDQMPDMIEELISRGQQLDAVH
FTYEVGLVDKFPPVPLLKAYLRDAKKSAASIMEESSNTGRPTHLVARKEQSALKAVLKCIEEYKLEEEFPPENLKKRLDQ
LEKTKTEKRKPAAVPANKRTRASYNGPMPPAKAGRITNAYVSSFPFIRSPSHSPQYASPAAYPSPPTTVYSNRSPPYPYS
PEIIPGSYQGSPIGYPAYNGYCNGPVPAPAPPVYHPHHHQHHQFHPQQHYY*

DNA
ATGGGGTCAGTCCCCGATCCAGGCGAGTTGACTGAGTTAGCTCAGCCGAGTTTCGAGGAGTTTCAGAAACAGACGTCGTT
GATGACAAGCTGTACTCTTCTATGGCAAGAGCTCTCCGATCACTTCACTTCTTTAGAGCAGAATCTGATGAAGAAATCTG
AAGCGTTGAAGCAGATGATTGAAACGCTAGACAATCAGACTCAGACCTCGCTTGAGTCTCTGAAGCGTAGAGAGGTAACA
ATCGACCATAGCGTTGAGATCGTAGCTGGGAAAGTTGGGGAACGAGCTAGAGCTGCTCTTGAATCGTTAGAGAAAGCTAG
AGATGGTGGTGATGGTTCTAATGATGATTCCGGTGAGGTTGACGATGAAGAAGGGCTTCTCTCTGCGTTGAAATCTCTAT
GTCTTAAAATGGATGCGAGAGGGTTTTGGAACTTTGTGACGGCGAGAAAGAAGGAATTGGAGAATCTCCGGTCAAAAATT
CCGGCGGCGTTGGTTGATTGTGTAGATCCGGCGATGTTAGTGCTTGAAGCGATATCTGAGGTTTTTCCGGTGGATAAAAG
AGGAGATAAAGTGAGCAATGATTATGGATGGGCTTGTGTTGTGATTCTAGAGAGTTTAACACCTGTAATGGTTGATCCAG
TGATTGGGAAATCGAGGTTGCTTGTTACTCCGAGCGTTAAGGAGAAGGCTAAGGAGATAGCTGAGACGTGGAAGGCGAGC
TTGGAAGAGAGAGGAAGGATAGAAAATGTGAAGACTCCTGATGTGCATACGTTTCTGCAGCACCTTGTTACATTTGGAAT
TGTTAAAAGTGAAGATCTTGCTTTGTATAGAAAGCTTGTCGTTGGATCTGCGTGGCGTAAACAGATGCCTAAGCTTGCTG
TTTCTGTTGGTTTGGGTGATCAAATGCCTGACATGATTGAAGAATTAATCAGCAGGGGACAACAGCTTGATGCTGTTCAT
TTTACTTATGAAGTTGGCCTTGTGGATAAGTTTCCTCCTGTTCCTTTGCTCAAAGCTTATCTAAGGGACGCAAAGAAGTC
AGCAGCATCTATCATGGAGGAATCTAGCAATACTGGCCGACCTACGCATCTCGTGGCGCGCAAGGAGCAATCAGCACTTA
AGGCGGTCTTGAAATGCATAGAAGAGTACAAACTCGAGGAAGAATTCCCTCCAGAGAACCTCAAGAAGCGGTTGGATCAG
CTAGAGAAGACCAAAACCGAGAAGAGAAAACCAGCAGCTGTTCCCGCAAACAAGAGAACCCGAGCAAGCTACAACGGTCC
AATGCCACCAGCCAAAGCCGGGCGTATCACAAACGCATACGTCTCTTCCTTCCCTTTCATCAGATCACCCTCTCACTCTC
CTCAATACGCTTCACCAGCAGCTTACCCATCCCCACCTACAACAGTCTACAGCAACAGAAGCCCACCTTATCCATACTCT
CCCGAAATCATCCCAGGCTCATACCAAGGCTCTCCTATCGGTTACCCAGCATACAACGGTTATTGCAATGGTCCAGTTCC
TGCTCCAGCTCCTCCGGTTTACCACCCGCACCATCATCAACACCACCAATTCCACCCTCAGCAACATTACTACTGA