Details for Lyrate rockcress Locus 16051644

Position : sca3 ( 5`- 2404702 .. 2404142 -3` )
Annotation : [B2G] ribosomal protein l12 family protein
External links : CoGe
PGDD synteny : 16051644

Protein [Map View]
MKLISLVRNVRSRQCQPEVIWSVQVRFLQQDSVSKAKPKKYKYPSVYDPYGPRPQPSNKIMELAECIAALSPEERKQIGP
ALNEHLRLPKQQMISSDGIGAKQDTGAGKVEEKKEKTAFDVKLEKFNASDKIKVIKEVRTFTSLGLKEAKELVEKVPAIL
KQGVTKEEANEIIAKIKAVGGVAVME*

DNA
ATGAAGCTTATTTCACTTGTCAGAAACGTTCGTTCTCGCCAATGTCAACCGGAAGTTATCTGGTCTGTGCAAGTTCGTTT
CTTGCAGCAAGATTCTGTCTCGAAAGCTAAACCCAAGAAATACAAATACCCGTCAGTTTATGATCCCTATGGTCCTAGAC
CCCAGCCTTCAAACAAAATCATGGAGTTAGCTGAGTGTATAGCTGCATTATCTCCAGAAGAACGGAAACAGATTGGTCCT
GCACTCAATGAACACCTGAGGCTTCCAAAACAACAGATGATTTCATCGGATGGCATTGGTGCAAAACAAGATACTGGAGC
TGGGAAAGTTGAGGAGAAGAAGGAGAAGACGGCTTTCGATGTGAAGTTGGAGAAGTTTAATGCATCTGATAAGATCAAAG
TGATAAAAGAAGTGAGAACGTTCACGAGTTTGGGTCTGAAGGAGGCGAAAGAGCTTGTGGAGAAAGTCCCCGCTATTCTT
AAACAAGGTGTGACAAAGGAAGAAGCTAATGAAATCATAGCAAAGATCAAAGCTGTAGGTGGAGTCGCAGTTATGGAGTG
A