Details for Lyrate rockcress Locus 16051627

Position : sca1 ( 5`- 29084616 .. 29083578 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051627

Protein [Map View]
MDQFSGGGGNWSMIPNVQAQGNFGTPTNHDQQLFLQQQQFHLQQQQTQQQQQQFQPQQQEMQQFQQFQQQQHFIQQQQFQ
QQQRLLQSPPLQTQSLQSPPPQQTVVHTPQSMMHTPQQQQQLVQTPVQTPQQHQSLASHFHLYPMVEKLADVIENGTRDQ
NSDALVTELNSHFDKCQQLLNSISGSLGSKTMTVDGQKRNVEESEQLLQQRRDLIVEYRKSIEEILKMEP*

DNA
ATGGATCAATTCTCAGGAGGAGGAGGTAATTGGTCGATGATCCCAAACGTGCAGGCGCAGGGTAACTTCGGTACACCGAC
CAATCATGACCAGCAACTATTCCTCCAGCAACAACAGTTTCATCTTCAACAACAACAGACGCAGCAGCAACAACAACAAT
TCCAGCCACAACAACAAGAGATGCAACAATTTCAGCAATTCCAACAACAGCAACACTTCATTCAACAACAGCAATTCCAA
CAACAACAACGGTTGTTACAATCTCCTCCTCTTCAGACACAGTCGTTGCAATCGCCTCCGCCGCAACAGACGGTGGTTCA
TACGCCTCAATCTATGATGCATACACCGCAGCAACAACAACAGTTGGTTCAAACTCCGGTGCAGACTCCGCAACAGCATC
AGTCTTTAGCTTCTCATTTCCATCTCTATCCGATGGTGGAGAAATTAGCCGATGTGATCGAAAATGGAACCCGAGATCAG
AATTCTGATGCACTGGTGACTGAATTGAATAGCCATTTCGATAAGTGTCAACAGTTGTTGAATTCGATTTCAGGATCACT
AGGATCTAAAACTATGACTGTTGATGGCCAAAAGCGAAATGTTGAAGAAAGTGAGCAATTGCTTCAACAAAGAAGGGATT
TGATTGTGGAGTATAGGAAATCTATTGAAGAGATTTTGAAGATGGAGCCTTAG