Details for Lyrate rockcress Locus 16051624

Position : sca3 ( 5`- 6224183 .. 6222369 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051624

Protein [Map View]
MLSQDLTFSKTLNPSFSFRNSPLNSGVRRIVSVLPVITERNYAFSVKRSELFLREDGRFRRDVRALAGRSKKKLGGGSSG
GRIEGDADMRKQVKRNARDKSKKLAESLFYRLYNNPDKSRSHILSSHPDKFTEEELEMIGLGYDRMVRFMDKDDPRLRHP
YDWFKYGEFGPYSWRGVVVGDPVRGTISDECVTMIGEVENHEEFEKIEQHEMNLAFQKRVKELDSNVGLRYFWVFVRHPK
WRLSELPWEQWTLVSEVVVEADKKQRLDKWNLMGRLGNKSRSLICQCAAWFRPDIVYVKKPVFQCRFEPQEDFFNSLIPY
LNPVTESGFVCEVEDDEGRVELSTYYGGLCKMLKVRQTAFVDDVVNAYEKSSDEKKSKVLKFLLGNHPNELLHPYTKEWK
AKLEEMELGCDAPDENEDETNFNGSSEKAEFSEWIEDEADNNDDDGEVEEEDDDDNMVVDVEGNDEEDSLEDEIEESDPE
EDERYWEEQFNKATNNAERMEKLAEMSMVVSDKFYEKQLKALEEREKGEIEGDELEMRGKKAKVKPEEWKTVGYGRWMKK
IKKSRIPPELFLRAAVRPFVYRNLVKEIVLTRHAILEGEIGQKE*

DNA
ATGCTGAGTCAAGATTTAACCTTTTCTAAAACCCTGAACCCTAGCTTCTCCTTCCGTAATTCTCCACTCAATTCCGGCGT
ACGAAGGATCGTTTCGGTTTTACCGGTTATTACCGAGAGGAATTATGCTTTCAGTGTCAAAAGGTCGGAGCTTTTTCTTA
GAGAAGATGGTAGATTCCGGCGAGACGTGCGGGCTTTGGCGGGGAGGAGCAAGAAGAAGCTTGGAGGAGGTTCATCTGGT
GGGAGGATAGAAGGAGATGCGGATATGAGGAAGCAGGTGAAGAGGAATGCTCGTGATAAGTCGAAGAAGCTTGCGGAATC
TTTGTTCTATAGATTGTATAATAACCCTGACAAGAGTCGGAGTCACATTCTCAGTAGTCATCCGGATAAGTTTACGGAGG
AAGAGCTTGAGATGATTGGGCTTGGTTACGATAGGATGGTTAGGTTTATGGATAAGGATGACCCGAGATTGCGTCATCCT
TATGATTGGTTTAAGTATGGTGAGTTTGGACCTTACTCGTGGCGTGGTGTTGTGGTTGGTGATCCGGTTCGTGGTACTAT
ATCTGATGAGTGTGTTACTATGATTGGTGAAGTGGAGAATCATGAAGAGTTTGAGAAGATTGAGCAGCATGAGATGAATT
TAGCTTTTCAGAAGAGGGTTAAGGAGTTGGATTCGAATGTTGGTTTGAGGTATTTTTGGGTGTTTGTCAGGCATCCGAAA
TGGAGACTCAGTGAGTTGCCGTGGGAGCAATGGACGTTGGTTAGTGAAGTGGTTGTGGAAGCGGATAAGAAGCAGAGGTT
GGATAAATGGAATTTGATGGGGAGGTTGGGGAACAAATCTCGGTCTTTGATATGTCAATGTGCGGCTTGGTTTAGACCTG
ATATTGTGTATGTGAAGAAGCCTGTGTTTCAGTGCAGGTTTGAGCCTCAAGAAGATTTCTTCAACTCGCTTATCCCTTAT
CTAAACCCGGTAACGGAATCTGGATTTGTGTGTGAAGTGGAGGATGATGAAGGTAGAGTGGAGCTGAGTACTTATTACGG
AGGGTTGTGTAAGATGTTGAAGGTGAGACAGACAGCTTTTGTGGATGATGTGGTGAATGCTTATGAGAAGTCGAGTGATG
AAAAGAAGTCCAAAGTGTTGAAGTTCTTGCTTGGAAACCACCCGAACGAGTTGTTGCATCCGTATACAAAGGAGTGGAAA
GCAAAGTTGGAGGAGATGGAGTTGGGGTGTGATGCTCCAGATGAAAATGAGGATGAGACAAATTTTAATGGAAGCTCAGA
GAAGGCTGAATTCTCAGAATGGATTGAAGATGAAGCTGACAATAACGATGACGATGGTGAGGTGGAGGAAGAAGATGATG
ATGATAACATGGTTGTGGATGTGGAGGGAAACGATGAAGAAGACAGTTTGGAAGATGAAATAGAGGAGTCGGATCCAGAA
GAGGATGAGAGGTACTGGGAAGAGCAATTCAACAAAGCGACAAACAACGCGGAGAGGATGGAGAAGCTTGCGGAGATGAG
TATGGTGGTGTCAGATAAGTTTTATGAGAAGCAGTTAAAGGCATTGGAGGAAAGAGAGAAGGGAGAGATTGAAGGAGATG
AGTTGGAAATGAGAGGTAAGAAGGCAAAAGTGAAGCCAGAAGAGTGGAAGACAGTAGGATATGGAAGGTGGATGAAGAAG
ATAAAGAAGAGTAGGATCCCACCTGAGCTGTTTCTCCGTGCTGCTGTTAGGCCTTTTGTTTACAGAAACCTTGTCAAAGA
GATTGTTCTTACAAGACACGCCATTTTGGAAGGCGAGATTGGTCAGAAGGAGTGA