Details for Lyrate rockcress Locus 16051610

Position : sca3 ( 5`- 2087771 .. 2090073 -3` )
Annotation : [B2G] alpha subunit of f-actin capping protein
External links : CoGe
PGDD synteny : 16051610

Protein [Map View]
MADEEDELPETELSYDQRKEIAKWFLLNAPAGEINYVAKDLKAVLSDEEVYNEAAMEAFPVYNKSHMICLEMPSRAGDVI
VSSYSEITENEYLDPRTAQVAIVDHVKQICTKVRPANDEELPSLYIEEYRYALDAEIQRYVSESYPKGMCAVNCVKGKDT
EGPGSDFELVVIITAMRLSPQNFCNGSWRSVWNIDFQDESQVLDIKGKLQVGAHYFEEGNVELDAKKDFQDSTIFQSADD
CAMAIANIIRHHETEYLASLEVAYSKLPDNTFKDLRRKLPVTRTLFPWQNTLQFSLTREVEKELGLGK*

DNA
ATGGCGGATGAAGAAGACGAGTTACCGGAGACAGAACTAAGTTACGACCAGAGGAAGGAAATCGCAAAGTGGTTTCTCCT
CAACGCTCCCGCCGGAGAAATCAATTACGTCGCTAAAGATTTAAAGGCGGTTTTGAGCGATGAGGAAGTCTACAATGAAG
CAGCCATGGAAGCATTTCCAGTGTACAACAAATCTCACATGATTTGCCTTGAAATGCCCAGTAGGGCTGGTGATGTGATT
GTGTCATCTTACAGTGAAATTACTGAAAATGAGTACCTTGATCCAAGAACTGCCCAGGTTGCCATAGTTGATCATGTTAA
ACAGATTTGTACAAAGGTACGGCCTGCAAATGATGAAGAACTTCCGTCTTTGTATATTGAGGAGTACAGATATGCTCTTG
ATGCTGAAATCCAGAGATATGTTAGTGAATCTTATCCGAAAGGTATGTGTGCAGTTAATTGTGTGAAGGGGAAAGATACT
GAGGGTCCAGGGTCCGACTTTGAGCTTGTTGTTATAATTACTGCCATGAGACTTAGTCCCCAGAACTTCTGTAATGGAAG
TTGGAGATCTGTATGGAACATAGATTTCCAGGATGAATCCCAGGTGCTTGACATAAAAGGGAAATTGCAGGTAGGAGCTC
ATTATTTTGAAGAGGGAAATGTGGAATTAGATGCAAAAAAAGATTTCCAAGATTCAACAATATTTCAGTCTGCGGATGAC
TGCGCGATGGCCATAGCCAATATTATCAGGCACCATGAAACAGAGTACCTTGCATCTCTAGAGGTAGCTTATTCAAAATT
ACCGGATAACACTTTTAAGGATTTGAGGAGGAAACTGCCGGTGACACGAACTCTGTTCCCATGGCAGAACACTTTACAGT
TCAGCCTGACAAGGGAGGTTGAGAAAGAACTTGGACTTGGCAAGTGA