Details for Lyrate rockcress Locus 16051572

Position : sca3 ( 5`- 1909416 .. 1912966 -3` )
Annotation : [B2G] aminotransferase class iv family protein
External links : CoGe
PGDD synteny : 16051572

Protein [Map View]
MAEPEVIHSWSAPRSLSTSLMYSFAQRDDTEVVDEPLYAAFLKATGVDRPYRDEVLSKMECSGDKVVKDVIYGSGSKKYR
YCKHISKQRLFGLSSELMRKGKHFILIRNPLNILPSFEKVHPPSFLELGLGELVSIYSDLCQMGTPPAVIDADELQRDPE
TTLRGLCDDLEIPFQASMLKWKAGPIPEDGVWAPWWYKSVHESTGFSSPKKYPRTFPLSHYDLLEQSLPLYNILRSHVKH
SSSLLSSPLPAPSLPVPENAKLLAWVGDEILPREMAKVSVFDSVVQGGDSVWEGLRIYKGKIFKLEEHLDRLFDSAKALA
FENVPAREEIKEAIFKTLITNGMFDNTHIRLSLTRGKKVTSGMSPAFNRYGCTLIVLAEWKPPVYDNDGGIVLVTATTRR
NSPNNLDSKIHHNNLLNNILAKIESNNTNAADAIMLDKDGYVSETNATNIFMVKKGCVLTPHADYCLPGITRATVMELVV
KENFILEERRISLSEFHTADEVWTTGTMGELSPVVKIDGRVIGDGKVGPVTRTLQNAYKKLTEDSGVPIPTYQEP*

DNA
ATGGCAGAACCGGAGGTGATTCACTCATGGTCTGCACCAAGATCTCTCAGCACCAGCCTCATGTACTCCTTTGCTCAGAG
AGATGACACTGAAGTTGTCGACGAGCCGTTGTATGCAGCATTTCTTAAAGCTACAGGTGTTGATAGGCCATACAGAGACG
AGGTTCTCTCCAAGATGGAGTGCAGTGGAGATAAAGTTGTGAAAGATGTCATATATGGATCTGGATCGAAGAAGTACCGG
TATTGTAAGCATATCTCGAAGCAGCGGCTTTTCGGTTTGTCAAGTGAACTGATGAGAAAAGGAAAGCATTTCATATTGAT
ACGAAATCCTCTTAACATACTGCCTTCCTTTGAGAAAGTACACCCTCCATCGTTTCTCGAATTAGGCTTGGGGGAATTAG
TGTCGATATACAGTGATCTCTGTCAGATGGGAACACCACCAGCAGTCATCGATGCGGATGAGCTTCAGCGAGATCCCGAG
ACAACACTACGCGGTCTTTGTGATGATTTGGAGATTCCATTTCAAGCCTCTATGCTTAAATGGAAGGCTGGTCCTATACC
AGAAGATGGAGTATGGGCACCATGGTGGTACAAGAGTGTGCACGAATCAACGGGTTTCTCATCTCCAAAGAAGTATCCTC
GGACATTCCCTTTGTCGCACTACGATTTGCTGGAGCAAAGTCTACCGCTTTACAACATTCTCAGGAGCCACGTGAAGCAC
AGCTCCTCCCTCTTGAGTAGTCCCTTGCCTGCTCCTAGTCTCCCAGTTCCTGAAAACGCAAAACTTCTTGCATGGGTCGG
TGACGAGATTTTGCCTCGTGAGATGGCAAAGGTTTCTGTTTTTGACTCGGTTGTACAAGGCGGTGACTCGGTATGGGAAG
GACTTCGGATTTACAAGGGAAAGATATTTAAGCTTGAAGAACATCTAGATCGGTTGTTTGATTCAGCAAAGGCTCTGGCT
TTCGAAAATGTTCCAGCGCGTGAAGAGATAAAAGAAGCAATCTTCAAAACTCTCATAACCAATGGTATGTTTGACAATAC
ACATATCAGGCTGTCTCTAACTCGAGGCAAAAAGGTAACTTCTGGAATGAGCCCTGCATTTAATCGATATGGATGTACTT
TAATCGTGCTTGCGGAATGGAAGCCTCCGGTGTATGACAATGATGGTGGAATTGTGCTGGTGACCGCAACCACACGCCGC
AACTCGCCTAATAATTTGGATTCCAAGATTCATCACAACAACCTTCTCAATAACATACTAGCAAAGATTGAAAGTAACAA
CACGAATGCCGCTGATGCCATTATGCTTGACAAGGATGGTTATGTGTCTGAAACCAATGCAACCAACATTTTCATGGTGA
AGAAAGGCTGTGTACTTACTCCTCACGCAGATTACTGTCTCCCTGGCATAACCAGAGCTACCGTCATGGAACTTGTGGTG
AAAGAGAACTTCATCTTAGAAGAAAGAAGAATCAGTCTCTCCGAATTCCATACAGCCGATGAGGTATGGACAACTGGAAC
TATGGGGGAACTAAGCCCGGTTGTGAAAATCGATGGACGTGTGATTGGTGACGGCAAAGTTGGACCGGTAACGAGAACAC
TGCAAAACGCTTACAAGAAACTGACAGAGGATTCAGGTGTGCCAATACCTACTTACCAAGAACCCTGA