Details for Lyrate rockcress Locus 16051561

Position : sca3 ( 5`- 5468199 .. 5466228 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478729 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051561

Protein [Map View]
MAALVRRFCRRSYFPVSGHGYRMLSTIENVSESGKSMNLYSAINQALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERF
GKSRVFNTPLCEQGIVGFGIGLAAMGNRVIAEIQFADYIFPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGH
YHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEPKWLYRQAVEDVPEDDYMIPLSEAEVIREGSDITL
VGWGAQLTIMEQACLDAETEGISCELIDLKTLIPWDKEIVETSVRKTGRLLISHEAPVTGGFGAEIAATIVERCFLRLEA
PVSRVCGLDTPFPLVFEPFYMPTKNKASFILDAIKSIVNY*

DNA
ATGGCAGCTCTTGTACGCAGATTCTGCCGGCGATCGTATTTTCCGGTCTCTGGTCATGGATATAGGATGCTCTCGACGAT
TGAAAATGTATCTGAAAGTGGTAAATCGATGAATTTGTACTCTGCTATTAATCAAGCTCTTCACATCGCTTTAGAGACCG
ATCCTCGGTCTTATGTGTTTGGGGAAGATGTTGGTTTTGGTGGTGTGTTCCGATGTACAACCGGATTAGCTGAACGTTTT
GGGAAATCTCGAGTTTTCAACACTCCTCTCTGCGAGCAAGGCATTGTTGGCTTTGGCATTGGTTTAGCTGCTATGGGAAA
TCGAGTCATTGCGGAAATTCAGTTTGCGGATTATATCTTCCCTGCTTTTGATCAGATTGTTAATGAGGCTGCAAAGTTCA
GATACCGAAGTGGAAACCAGTTTAACTGTGGAGGACTTACAATTAGAGCACCTTATGGAGCCGTTGGTCACGGTGGACAT
TACCACTCGCAGTCCCCTGAAGCTTTCTTCTGTCATGTCCCTGGTATCAAAGTTGTTATTCCTCGAAGTCCACGGGAAGC
TAAGGGATTATTATTGTCATCCATCCGTGATCCGAATCCCGTTGTCTTTTTCGAACCAAAGTGGCTATATCGTCAAGCGG
TAGAGGATGTCCCTGAGGATGACTATATGATACCTTTATCTGAGGCAGAGGTTATACGAGAAGGTTCTGACATAACGCTT
GTTGGATGGGGAGCACAGCTCACTATCATGGAACAAGCATGTCTTGACGCAGAAACCGAAGGCATATCGTGTGAATTGAT
AGATCTCAAGACTCTGATCCCTTGGGATAAGGAAATCGTTGAGACCTCAGTGAGAAAGACTGGCAGACTTCTTATTAGCC
ATGAAGCTCCTGTTACAGGAGGCTTTGGGGCAGAGATCGCTGCAACTATAGTTGAGCGTTGCTTCTTAAGGTTAGAAGCA
CCTGTAAGCAGAGTTTGTGGCCTGGACACTCCTTTCCCTCTAGTGTTCGAACCTTTCTACATGCCAACCAAGAACAAGGC
AAGTTTTATATTGGATGCAATCAAATCAATTGTGAATTACTAG