Details for Lyrate rockcress Locus 16051521

Position : sca3 ( 5`- 6528723 .. 6529043 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051521

Protein [Map View]
MQVARRIPSGEGVEMPGRSETNRVRRRSHGSGLRVRVACTCSGRPGSTKCARHGFMVPSDERLMQKASDGSREVLRRALT
PPIRRMNLRWLNFRPTPSRLCKMSSV*

DNA
ATGCAGGTTGCGAGAAGGATCCCATCAGGAGAAGGCGTAGAGATGCCGGGAAGATCAGAGACGAATCGGGTCAGACGAAG
AAGCCACGGCTCGGGTCTGAGGGTTCGAGTAGCTTGCACGTGCTCAGGACGGCCTGGTTCGACGAAGTGTGCACGGCACG
GGTTTATGGTGCCAAGCGATGAGAGGCTTATGCAGAAGGCGAGTGACGGAAGCAGAGAGGTGTTGAGGAGAGCTTTGACA
CCTCCGATCCGGCGGATGAATCTCCGGTGGTTGAATTTCAGGCCAACACCTAGCCGACTCTGTAAAATGTCTTCTGTTTG
A