Details for Lyrate rockcress Locus 16051479

Position : sca3 ( 5`- 4664252 .. 4661906 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051479

Protein [Map View]
METQNKLMNEAKRHVDSRLCRVSGLMTEIMEIQAENPTFYVLFIPGNPGVVSFYKEFLESLYEFLDGNASVIAIGQISHT
SKDWESGRLFSFQEQIDHKIDFIRQELESVKLPIILVGHSIGSYISLEMLRKFSEKVVYCIGLYPFLTLNQQSTKQSLIG
KLAASSILSATASFLIASLRLLPMSAARLLVSKSIGASWSDTAVQATCTHLRQYHTMRNVLFMAKSEFRELAAEPDWDFM
RENQSKLAFLFGIDDHWGPLQLFEEISKQAPGTSLAIEREGHTHGFCCTVAGSAWVAQHVATLIKNRFSQLQ*

DNA
ATGGAGACTCAAAACAAATTGATGAATGAAGCTAAAAGACATGTTGATTCCAGATTGTGCAGAGTTTCTGGTTTGATGAC
GGAGATAATGGAAATTCAAGCTGAGAATCCCACATTCTATGTATTGTTTATTCCGGGAAATCCAGGAGTTGTGTCATTTT
ACAAGGAGTTTTTGGAATCTTTATACGAGTTTCTTGATGGAAATGCTTCTGTAATTGCTATTGGACAAATATCTCACACG
AGCAAGGACTGGGAATCTGGGAGGCTATTTTCATTTCAAGAACAAATCGATCATAAGATTGATTTTATCAGACAGGAGTT
GGAGAGTGTGAAACTTCCAATAATATTGGTTGGGCATTCTATTGGGTCTTATATATCCCTTGAAATGTTGAGGAAGTTCT
CGGAGAAGGTGGTATATTGCATTGGCCTATATCCATTTTTGACTTTGAACCAACAATCAACAAAGCAATCATTAATTGGG
AAACTTGCAGCGTCTTCTATTCTGTCAGCTACCGCAAGTTTTCTGATTGCATCGCTGAGACTTTTACCTATGTCAGCTGC
ACGGCTGCTTGTATCCAAATCCATTGGAGCTTCATGGTCTGATACTGCTGTTCAAGCTACCTGCACTCACTTGAGACAGT
ATCACACCATGCGCAATGTCCTCTTCATGGCAAAGTCAGAGTTTAGAGAGCTTGCAGCTGAGCCAGATTGGGATTTTATG
AGAGAAAACCAGAGCAAGCTTGCATTTCTATTTGGCATTGATGATCATTGGGGTCCACTGCAACTCTTTGAAGAGATTTC
GAAGCAGGCTCCAGGTACATCCTTGGCTATTGAGAGGGAAGGTCACACGCACGGATTCTGCTGCACTGTGGCTGGCTCAG
CATGGGTAGCGCAGCACGTAGCCACTCTGATCAAGAACCGGTTTTCACAGCTTCAGTAA