Details for Lyrate rockcress Locus 16051470

Position : sca3 ( 5`- 9478919 .. 9481464 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342288 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16051470

Protein [Map View]
MISGYSKELVIMSGTELEEPGQLKRAVIDASAGAVAGAISRMVTSPLDVIKIRFQGFWRGNVPALLMVVPYTSVQFAVLH
KVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGL
SPTLIEIIPYAGLQFGTYDTFKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLSGLASGTVSKLVCHPLDVVKKRFQVEG
LQRHPKYGARVELNAYKNMFDGLGQILRSEGWHGLYKGIVPSTIKAAPAGAVTFVAYELASDWFEANLT*

DNA
ATGATTTCAGGTTATAGCAAGGAGCTGGTGATCATGAGTGGTACAGAGTTAGAAGAGCCTGGACAGTTAAAACGTGCTGT
GATTGATGCTTCCGCTGGTGCTGTTGCTGGTGCCATTTCACGTATGGTTACCTCTCCTCTTGATGTTATCAAGATTAGAT
TTCAGGGTTTTTGGCGTGGAAATGTCCCAGCTTTACTTATGGTTGTGCCTTATACATCCGTACAATTTGCAGTTTTACAT
AAGGTGAAGTCTTTTGCCGCTGGTTCATCAAAGGCCGAAAATCATGCTCAACTGAGCCCTTATCTTTCATACATTAGCGG
GGCACTAGCAGGGTGTGCAGCAACAGTTGGATCGTATCCATTTGACCTATTGCGGACTGTATTGGCTTCCCAGGGTGAGC
CAAAGGTATATCCAAATATGAGGTCAGCATTTCTGAGTATAGTGCAAACTCGTGGAATCAAAGGGTTGTATGCAGGATTG
TCCCCAACTTTGATCGAGATCATTCCTTATGCTGGTCTGCAGTTCGGCACTTATGACACATTTAAACGCTGGAGTATGGT
ATATAATAAGCGATACCGATCATCTTCATCAAGCTCAACGAATCCAAGTGATAGTCTTTCTAGCTTTCAGCTCTTCCTTT
CCGGTTTAGCTTCTGGCACTGTTTCTAAACTAGTCTGTCATCCGCTTGATGTTGTCAAGAAAAGATTCCAAGTCGAAGGT
CTGCAACGTCACCCAAAATATGGAGCCCGAGTAGAGCTAAATGCTTACAAGAACATGTTTGACGGTTTAGGGCAGATATT
AAGATCAGAAGGTTGGCACGGCCTTTACAAAGGCATTGTTCCATCAACCATAAAAGCTGCACCAGCTGGTGCTGTAACAT
TTGTGGCCTATGAACTGGCATCCGATTGGTTTGAGGCAAATTTGACATGA