Details for Lyrate rockcress Locus 16051424

Position : sca3 ( 5`- 3412360 .. 3412074 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051424

Protein [Map View]
MSLVWLEAMLPLGIIGGMLCIMGNSQYYIHKAYHGRPKHIGHDEWDVAMERRDKKVVEKAGAPSS*

DNA
ATGTCGTTGGTCTGGTTGGAAGCGATGTTGCCTCTCGGAATCATCGGTGGGATGCTCTGTATCATGGGGAATTCTCAGTA
CTACATCCACAAAGCTTATCATGGCCGTCCGAAGCACATCGGCCACGATGAATGGGATGTTGCTATGGAAAGACGCGACA
AGAAAGTCGTCGAGAAAGCTGGAGCTCCTTCGTCATGA