Details for Lyrate rockcress Locus 16051423

Position : sca3 ( 5`- 2720471 .. 2718024 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16051423

Protein [Map View]
MIDIPPYPPLDPSNYDLIIVGTGVSESVLAAAASSSGSSVLHLDPNPFYGSHFASLSLPDLTSFLHSNSFSSPPPPSSPP
LPPSNNHDFISVDLVNRSLYSSVEISSFESEILEEHSRRFNVDLCGPRVVFCADESINLMLKSGANNYVEFKSIDASFVG
DSSGELRNVPDSRAAIFKDKSLTLLEKNQLMKFFKLVQSHLASSTENDDTTTVKISEEDMESPFVDFLTKMRLPPKIKSI
ILYAIAMLDYDQDNMETCRHLLKTKEGIDRMALYIISMGRFSNALGALIYPIYGQGELPQAFCRRAAVKGCIYVLRMPIT
ALLLDKETGGYKGVRLASGQEIFSQKLILDPCVTVGLESLSSLTDQQNETLSVLVPKALINKEKVSRGICVIRGSVKADV
SNALIVYPPKSLFPEQLTAIRVMQLGSGLAVCPADMHVLYLSTLCDNDDQGIKSLLSAMSNLIRLPDPENHQSDSVVEND
TCEAKPILLWRALYVQELVKGEYGGTISSMPSPDGNLNYNEIVESALKLYEQLMGSEELFKEETSVENTTEENDGGVDIE
D*

DNA
ATGATCGACATCCCTCCTTACCCGCCGCTTGACCCTTCTAACTACGATCTCATTATCGTCGGCACCGGAGTCTCTGAGTC
CGTCTTAGCCGCCGCTGCTTCCTCCTCCGGTAGTTCTGTTCTCCACCTCGACCCTAACCCCTTCTACGGCTCTCACTTCG
CCTCTCTTTCTCTTCCCGATCTCACTTCTTTCCTTCACTCAAACTCCTTTTCTTCTCCTCCGCCGCCGTCATCTCCTCCT
CTCCCTCCGTCAAACAACCATGACTTCATCTCCGTGGATCTCGTTAACCGATCCTTGTATTCCTCCGTTGAGATTTCGAG
CTTCGAATCGGAGATCCTCGAAGAACACTCTAGAAGATTCAACGTTGACTTGTGTGGTCCTAGGGTTGTCTTCTGTGCCG
ATGAATCAATTAATCTCATGTTGAAATCAGGAGCTAACAATTACGTTGAGTTCAAGAGTATCGACGCGAGCTTCGTCGGG
GATTCGAGCGGTGAGCTACGAAATGTGCCGGATTCGAGAGCTGCGATTTTCAAGGACAAGAGCTTGACTCTGTTGGAGAA
GAATCAGCTCATGAAATTCTTCAAGCTTGTTCAGAGTCACTTGGCTTCGTCTACGGAAAATGATGATACAACAACAGTCA
AGATATCGGAGGAAGACATGGAGAGTCCATTTGTGGACTTCTTGACAAAGATGCGTTTGCCACCCAAAATCAAATCGATC
ATCTTGTATGCCATTGCGATGCTAGATTATGATCAAGACAATATGGAAACTTGTAGACATTTACTCAAGACCAAAGAGGG
CATAGATCGAATGGCTCTATACATCATATCTATGGGCAGGTTTTCTAACGCACTTGGGGCATTGATATACCCAATTTATG
GACAAGGAGAACTTCCACAAGCCTTTTGTCGTCGGGCTGCTGTCAAAGGATGTATCTATGTTCTCCGGATGCCTATTACT
GCTCTGCTTTTAGACAAGGAAACTGGGGGTTACAAAGGGGTTAGATTAGCTTCTGGTCAAGAGATATTCAGCCAAAAGTT
GATTCTGGATCCATGTGTTACTGTTGGATTAGAGTCTCTGTCGTCATTGACAGATCAGCAAAATGAAACTCTCAGTGTTC
TTGTCCCAAAGGCGTTGATCAATAAGGAGAAAGTATCAAGAGGAATATGTGTCATTAGAGGTTCTGTGAAAGCTGATGTA
TCAAACGCTCTTATCGTATATCCACCTAAATCTTTGTTTCCTGAACAGCTAACTGCAATTCGGGTTATGCAGCTTGGTAG
TGGTTTAGCGGTTTGTCCTGCTGACATGCATGTTTTATATCTTTCAACTTTGTGTGACAACGATGACCAAGGGATAAAGT
CGCTATTATCAGCCATGAGTAATCTCATCAGATTGCCTGATCCCGAGAATCATCAAAGCGATTCCGTTGTTGAGAATGAT
ACTTGTGAGGCAAAACCTATTCTACTCTGGAGAGCACTATACGTGCAAGAGCTAGTCAAGGGTGAATATGGAGGTACTAT
CAGTTCCATGCCTAGTCCAGATGGAAATTTGAACTACAATGAGATAGTGGAATCAGCCTTGAAGCTATATGAACAACTCA
TGGGGAGTGAAGAATTATTTAAAGAAGAGACCTCAGTGGAAAACACAACGGAGGAAAACGATGGTGGTGTTGACATAGAA
GATTGA